KEGG   Lactobacillus reuteri DSM 20016: Lreu_1777Help
Entry
Lreu_1777         CDS       T00535                                 

Definition
galactokinase
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lreu_1777
   00520 Amino sugar and nucleotide sugar metabolism
    Lreu_1777
Enzymes [BR:lre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     Lreu_1777
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lreu_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1829692..1830870)
Genome map
AA seq 392 aa AA seqDB search
MDKQQFLAEYQDVFKEPGKDVFFSPGRINVIGEHTDYNGGHVFPCAISIGTYGVYGPRED
TTVAIYSANSAKEEDSKIITFDINDTEPQNAKDEKWVNYFKGMLVYLKQRGFKIDHGFNL
YIHGFLPYGSGLSSSASIEMLMGNILKDEFNLDIDEIELVKLGQKTENDFVGLNSGIMDQ
FAVGMGKENNAIYLDCNTLEYKYLPLELGDYEIIIMSTNKNHSLAGSKYNERVQECEEAV
KRLNKKLDINKLGELDSDTFDQYTYLIDDDTLIRRARHAVSENERTKKAIDAMEKGDLEE
LGRLINASHVSLKYDYEVTGKELDTLAENAWNQPGCLGARMVGGGFAGSAIAIVKKSEAE
NFKKNVGKIYRDKIGYDASFYDAEVVDGPHKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggataagcaacaatttttagctgaataccaagacgtgtttaaagaaccgggtaaggat
gtattcttttcaccaggccgaattaatgtaatcggggaacatactgattataatggcggc
catgtttttccatgtgcgatcagtattggaacctatggggtatatggtccgcgtgaagat
acaacagtagccatttactcagctaattcggcaaaagaagaagatagtaagattattact
tttgacattaatgatacagaaccgcaaaatgctaaagatgaaaagtgggttaactacttt
aaggggatgttggtttatctaaagcaacggggcttcaagattgatcacggatttaactta
tacatccacggttttcttccttatggttcaggcttatcgtcatcagcatcaattgaaatg
ttgatgggaaatatcttgaaggatgaatttaatcttgatattgatgaaattgaattagtt
aaacttggccaaaagactgaaaatgatttcgttggtcttaattccggaatcatggaccaa
tttgctgtcggaatgggtaaagaaaataacgcaatttatcttgactgcaacactcttgaa
tataagtatctgccgcttgaacttggcgattatgaaatcattatcatgagtactaataag
aaccactccttagctggttccaaatacaacgaacgggtccaagaatgcgaagaagcagtt
aaacgtcttaacaagaagcttgatattaacaaacttggggaattagactccgatacattt
gatcaatacacttacttaattgatgatgacacactgattcgtcgtgcccgtcatgcagtt
agtgaaaatgaacggacaaagaaagccattgatgcaatggaaaagggcgatcttgaagaa
ttaggccgtctgatcaatgcttctcatgtatcacttaaatatgattatgaagtgactggt
aaagagcttgacaccttagcagaaaacgcatggaatcaaccaggctgccttggtgctcga
atggtcggcggtggatttgccggcagtgcgattgccattgttaagaagtcagaagcagaa
aacttcaaaaagaatgttggaaagatctaccgggacaagattggttacgatgccagtttc
tatgatgctgaagttgttgatggaccacataagctttaa

DBGET integrated database retrieval system