KEGG   Lactobacillus reuteri JCM 1112: LAR_0108Help
Entry
LAR_0108          CDS       T00735                                 

Definition
purine nucleoside phosphorylase
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LAR_0108
   00240 Pyrimidine metabolism
    LAR_0108
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LAR_0108
Enzymes [BR:lrf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     LAR_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140142..140852
Genome map
AA seq 236 aa AA seqDB search
MSTHINAKMGDYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNAFGYTGEYKGHRISVQ
GSGMGIPSMSIYINELVREFGVKTIIRVGSCGGIAPDVHVRDVLLAQGSSTDSAVTVNTF
GPGFHYAPLADFKLLDTAYHVAGKLGIETKVGDIFAADRFYNDELDMEKLRDYGILGTEM
ESAGLYLLAAKLHFRALSVLTVSDLIFGDEKATAEERERTFNDMINISLETAIAGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacatattaatgcaaaaatgggtgactacgcagacactgtattacttccgggg
gatccgctgcgtgcaaaatatattgcagaaaacttcttggaaaatgttaaacaagtaaat
tcagtccggaatgcctttggttatactggtgaatataagggtcatcgtatttcagtacaa
ggatctgggatgggaattccttcgatgtcaatttatattaatgagttagtacgcgaattt
ggtgttaaaaccattatccgggttggttcttgtggcggaattgctccagatgttcatgtt
cgcgatgttcttcttgcccaaggttcttcaaccgattcagcagtaacggtaaatacattt
ggaccaggattccattacgcaccattagctgatttcaagttgttagatactgcctatcat
gtagctggtaaattaggtattgaaacaaaagttggagatatctttgctgccgatcgtttt
tacaatgatgagcttgatatggaaaagcttcgtgactatggaattttaggaacagaaatg
gaatctgccggactttacttgttagcggctaagcttcatttccgggcactttcagttttg
actgttagtgacttaatctttggtgacgaaaaagcaactgctgaagaacgtgaacgaaca
tttaatgatatgattaatatttcgcttgaaacggcgattgctggaaagtag

DBGET integrated database retrieval system