KEGG   Lactobacillus reuteri JCM 1112: LAR_0117Help
Entry
LAR_0117          CDS       T00735                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LAR_0117 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LAR_0117 (pyrB)
Enzymes [BR:lrf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LAR_0117 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147872..148801
Genome map
AA seq 309 aa AA seqDB search
MISTERIQPNLVTVADMDAADAIDLIHEAQAYKAGKQAVLTAPAYAVNLFFENSTRTKTS
FQMAQMKLGMNVLEFEAGTSSVKKGESLYDTVKTMESIGVNVAVIRHPENEYYNQLINHS
DLKIGIVNGGDGSGQHPSQCLLDMMTINEEFGDFKGLKVLIIGDLSHSRVAHSNAMMLNR
LGAEVYFAGPEKWYDPTLEQYGTFGDFDELLPQMDVVNLLRVQNERLTTADGQAFDANQY
HQAYGLTLERAAKMKQGAIIMHPAPVNRGVEIDSSLVEAPNSRIFQQMTNGVYTRMAILS
RVLRYQGLM
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattagtacagaaagaattcaaccaaatttagtaacagttgccgacatggacgcagca
gatgcaattgatttaattcatgaagcccaagcatataaagctgggaagcaagcggttctc
actgcaccggcatacgcggttaacctcttctttgaaaactcaacccgaacaaagactagt
ttccaaatggcacaaatgaagttggggatgaatgtactagaattcgaagcgggcacgagt
tcagtgaaaaaaggggaaagcctctatgacactgttaagacaatggaatcaatcggtgta
aatgttgcggtaatccgtcatcctgaaaatgaatattacaaccaattgattaatcattca
gaccttaagatcggaattgtaaatggtggtgatggtagtggtcaacacccatcccaatgt
ttacttgatatgatgacaattaatgaagaatttggcgatttcaagggcttaaaagtacta
attattggtgatcttagtcactctcgagtagcgcactcaaatgcaatgatgcttaatcgt
ctaggagcagaggtttattttgctggcccagaaaaatggtatgatcctacactggaacaa
tatggaacttttggtgactttgacgaattgcttcctcaaatggatgtagttaatttacta
cgagttcaaaatgaacggctaacgactgctgacggtcaggcttttgatgctaatcaatat
caccaagcttatggtttaactttagagcgggccgcaaagatgaagcagggtgcaatcatt
atgcatccagcgccagttaaccggggtgttgaaattgatagctcccttgttgaagcgcct
aattcccgcattttccaacaaatgacaaacggcgtatatacccggatggcaattcttagt
cgagttcttcgttaccaaggattgatgtaa

DBGET integrated database retrieval system