KEGG   Lactobacillus reuteri JCM 1112: LAR_0117Help
Entry
LAR_0117          CDS       T00735                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lrf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lrf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147872..148801
Genome map
AA seq 309 aa AA seqDB search
MISTERIQPNLVTVADMDAADAIDLIHEAQAYKAGKQAVLTAPAYAVNLFFENSTRTKTS
FQMAQMKLGMNVLEFEAGTSSVKKGESLYDTVKTMESIGVNVAVIRHPENEYYNQLINHS
DLKIGIVNGGDGSGQHPSQCLLDMMTINEEFGDFKGLKVLIIGDLSHSRVAHSNAMMLNR
LGAEVYFAGPEKWYDPTLEQYGTFGDFDELLPQMDVVNLLRVQNERLTTADGQAFDANQY
HQAYGLTLERAAKMKQGAIIMHPAPVNRGVEIDSSLVEAPNSRIFQQMTNGVYTRMAILS
RVLRYQGLM
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattagtacagaaagaattcaaccaaatttagtaacagttgccgacatggacgcagca
gatgcaattgatttaattcatgaagcccaagcatataaagctgggaagcaagcggttctc
actgcaccggcatacgcggttaacctcttctttgaaaactcaacccgaacaaagactagt
ttccaaatggcacaaatgaagttggggatgaatgtactagaattcgaagcgggcacgagt
tcagtgaaaaaaggggaaagcctctatgacactgttaagacaatggaatcaatcggtgta
aatgttgcggtaatccgtcatcctgaaaatgaatattacaaccaattgattaatcattca
gaccttaagatcggaattgtaaatggtggtgatggtagtggtcaacacccatcccaatgt
ttacttgatatgatgacaattaatgaagaatttggcgatttcaagggcttaaaagtacta
attattggtgatcttagtcactctcgagtagcgcactcaaatgcaatgatgcttaatcgt
ctaggagcagaggtttattttgctggcccagaaaaatggtatgatcctacactggaacaa
tatggaacttttggtgactttgacgaattgcttcctcaaatggatgtagttaatttacta
cgagttcaaaatgaacggctaacgactgctgacggtcaggcttttgatgctaatcaatat
caccaagcttatggtttaactttagagcgggccgcaaagatgaagcagggtgcaatcatt
atgcatccagcgccagttaaccggggtgttgaaattgatagctcccttgttgaagcgcct
aattcccgcattttccaacaaatgacaaacggcgtatatacccggatggcaattcttagt
cgagttcttcgttaccaaggattgatgtaa

DBGET integrated database retrieval system