KEGG   Lactobacillus reuteri JCM 1112: LAR_0140Help
Entry
LAR_0140          CDS       T00735                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00010  Glycolysis / Gluconeogenesis
lrf00260  Glycine, serine and threonine metabolism
lrf00680  Methane metabolism
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
lrf01200  Carbon metabolism
lrf01230  Biosynthesis of amino acids
Module
lrf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_0140
  Energy metabolism
   00680 Methane metabolism
    LAR_0140
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAR_0140
Enzymes [BR:lrf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAR_0140
Membrane trafficking [BR:lrf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LAR_0140
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAR_0140
  Exosomal proteins of melanoma cells
   LAR_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAG24656
Position
173297..173983
Genome map
AA seq 228 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEQAKNAGKALKEHGIEFDYAYTSVLKR
AIKTLHYALEECDQLWIPEYKTWRLNERHYGALQGHNKQKAAEKYGDEQVHIWRRSYDVL
PPLLSADDEGSAAKDRRYANLDPRAIPGGENLKVTLERVIPLWQDEIAPKLLDNKNVIIA
AHGNSLRALSKYIENISDEDIMNLEMATGQPVVYDFDDKLNVLSKEKY
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattaattcgtcacggtcaaagtgaatggaacttatctaaccaattt
actggttgggttgatgttgatttaagtgaaaagggtgttgaacaagcaaagaatgctggt
aaagcccttaaggaacacggcattgaatttgactacgcatacacttctgttttgaagcgt
gctatcaagactttgcactatgctcttgaagaatgtgaccaattatggattcctgaatac
aagacttggcgtttaaacgaacgtcactatggtgcacttcaaggccacaacaagcaaaag
gccgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgtatta
cctccattgctaagtgctgacgatgaaggttctgctgcaaaggatcgtcgttacgctaac
ttagacccacgtgctattcctggtggtgaaaacttaaaggttactttggaacgtgttatt
ccattatggcaagatgaaattgcaccaaagcttttggacaacaaaaacgttatcatcgct
gcccacggtaactctcttcgtgcattgagcaagtacatcgaaaacatttctgatgaagat
atcatgaaccttgaaatggctactggtcaaccagttgtttacgacttcgatgacaagctt
aacgtattaagcaaggaaaagtactaa

DBGET integrated database retrieval system