KEGG   Lactobacillus reuteri JCM 1112: LAR_0140Help
Entry
LAR_0140          CDS       T00735                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAR_0140 (gpmA)
   01230 Biosynthesis of amino acids
    LAR_0140 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_0140 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LAR_0140 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAR_0140 (gpmA)
Enzymes [BR:lrf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAR_0140 (gpmA)
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAR_0140 (gpmA)
  Exosomal proteins of melanoma cells
   LAR_0140 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
173297..173983
Genome map
AA seq 228 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEQAKNAGKALKEHGIEFDYAYTSVLKR
AIKTLHYALEECDQLWIPEYKTWRLNERHYGALQGHNKQKAAEKYGDEQVHIWRRSYDVL
PPLLSADDEGSAAKDRRYANLDPRAIPGGENLKVTLERVIPLWQDEIAPKLLDNKNVIIA
AHGNSLRALSKYIENISDEDIMNLEMATGQPVVYDFDDKLNVLSKEKY
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattaattcgtcacggtcaaagtgaatggaacttatctaaccaattt
actggttgggttgatgttgatttaagtgaaaagggtgttgaacaagcaaagaatgctggt
aaagcccttaaggaacacggcattgaatttgactacgcatacacttctgttttgaagcgt
gctatcaagactttgcactatgctcttgaagaatgtgaccaattatggattcctgaatac
aagacttggcgtttaaacgaacgtcactatggtgcacttcaaggccacaacaagcaaaag
gccgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgtatta
cctccattgctaagtgctgacgatgaaggttctgctgcaaaggatcgtcgttacgctaac
ttagacccacgtgctattcctggtggtgaaaacttaaaggttactttggaacgtgttatt
ccattatggcaagatgaaattgcaccaaagcttttggacaacaaaaacgttatcatcgct
gcccacggtaactctcttcgtgcattgagcaagtacatcgaaaacatttctgatgaagat
atcatgaaccttgaaatggctactggtcaaccagttgtttacgacttcgatgacaagctt
aacgtattaagcaaggaaaagtactaa

DBGET integrated database retrieval system