KEGG   Lactobacillus reuteri JCM 1112: LAR_0162Help
Entry
LAR_0162          CDS       T00735                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00010  Glycolysis / Gluconeogenesis
lrf00051  Fructose and mannose metabolism
lrf00562  Inositol phosphate metabolism
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
lrf01200  Carbon metabolism
lrf01230  Biosynthesis of amino acids
Module
lrf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_0162
   00051 Fructose and mannose metabolism
    LAR_0162
   00562 Inositol phosphate metabolism
    LAR_0162
Enzymes [BR:lrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LAR_0162
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LAR_0162
  Exosomal proteins of bladder cancer cells
   LAR_0162
  Exosomal proteins of melanoma cells
   LAR_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAG24678
Position
203038..203808
Genome map
AA seq 256 aa AA seqDB search
MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLK
IIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMG
VTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVVVSYEPSWAVGYGQHANP
VLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLIGRASLDV
DNFLRMVNYLKNDQEK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccctttattgctgctaattggaagatgcataagaatgtccaagaatcggtt
gaatttgtggatgcaattaaaggaaagctaccagatccgcaagaagttgaagtcggaatt
gcagcccaagcttttgcattacccagtatggttcaagccgctgatgattcaggattaaag
ataatcgcgcaaaacgcggcggctgaatattcgggagctttcactggtgaaattagctta
cgaggtttagctgacgccggtgtttcatatgtaatgttaggacatattgaacggcgccat
ttattccacgaggataatgagttggttaatcggaaagtgttggcagcccttcaaatggga
gttaccccgataatttgtacggatgaaacgatggtccagaaagaagttaatggtgaaatt
cactacgttttccagcaattgatgagcgtattgaggggcgtttctcttgatcaaattaaa
aatgtagttgtttcctatgaaccaagttgggcagttggatatggtcagcatgctaatcca
gttcttgctgaagaaggatgccgtcaaattcggcgaacgattgctgataactacacttat
gagattgctgataagatcaggattctttatgggggcagtgtcaatccagataatatcgga
atgattatgaacaagccagatgtagatggggtattaatcggtcgggcaagtttagatgtt
gataattttttgcgaatggtcaattatttaaaaaatgatcaagaaaaataa

DBGET integrated database retrieval system