KEGG   Lactobacillus reuteri JCM 1112: LAR_0162Help
Entry
LAR_0162          CDS       T00735                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAR_0162
   01230 Biosynthesis of amino acids
    LAR_0162
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_0162
   00051 Fructose and mannose metabolism
    LAR_0162
   00562 Inositol phosphate metabolism
    LAR_0162
Enzymes [BR:lrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LAR_0162
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LAR_0162
  Exosomal proteins of bladder cancer cells
   LAR_0162
  Exosomal proteins of melanoma cells
   LAR_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203038..203808
Genome map
AA seq 256 aa AA seqDB search
MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLK
IIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMG
VTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVVVSYEPSWAVGYGQHANP
VLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLIGRASLDV
DNFLRMVNYLKNDQEK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccctttattgctgctaattggaagatgcataagaatgtccaagaatcggtt
gaatttgtggatgcaattaaaggaaagctaccagatccgcaagaagttgaagtcggaatt
gcagcccaagcttttgcattacccagtatggttcaagccgctgatgattcaggattaaag
ataatcgcgcaaaacgcggcggctgaatattcgggagctttcactggtgaaattagctta
cgaggtttagctgacgccggtgtttcatatgtaatgttaggacatattgaacggcgccat
ttattccacgaggataatgagttggttaatcggaaagtgttggcagcccttcaaatggga
gttaccccgataatttgtacggatgaaacgatggtccagaaagaagttaatggtgaaatt
cactacgttttccagcaattgatgagcgtattgaggggcgtttctcttgatcaaattaaa
aatgtagttgtttcctatgaaccaagttgggcagttggatatggtcagcatgctaatcca
gttcttgctgaagaaggatgccgtcaaattcggcgaacgattgctgataactacacttat
gagattgctgataagatcaggattctttatgggggcagtgtcaatccagataatatcgga
atgattatgaacaagccagatgtagatggggtattaatcggtcgggcaagtttagatgtt
gataattttttgcgaatggtcaattatttaaaaaatgatcaagaaaaataa

DBGET integrated database retrieval system