KEGG   Lactobacillus reuteri JCM 1112: LAR_0206Help
Entry
LAR_0206          CDS       T00735                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAR_0206 (ipk)
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LAR_0206 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250181..251032
Genome map
AA seq 283 aa AA seqDB search
MIVTEKAPAKLNLSLDTPMRYFDGSPQWDMVMVSADLADYVTVETHRRPATIKVYTNSGF
LPNDQRNLAYQAAHILRSRFHCKDGVTIRIKKQIPVAAGLGGGSSDAAAVLRALNSIWRL
GLSLSELAKIALTIDSDVPYCIYNKLAHVTGHGEKIELLPPQPHYWAVIAKQKISVSTPQ
ILRQINYEKLQHLNNEALLTNLKKEDWQEATKYMGNVLEPLTMKFYPEIGRLKNKMKELG
ADVAQMSGTGPTVFAICHTESRAKRIQNSIRGFCRDVHVVTLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatagttacagaaaaagcaccagcaaaattgaatttgagtttagatacgccgatgcga
tattttgatggttctcctcaatgggatatggtaatggtttcggcagacctggctgattat
gtaactgttgagacacaccggcgccctgcaacaattaaagtttatacaaatagtggcttt
ttacccaatgaccaacgtaatttagcataccaagcagctcatattttacgtagtcgtttt
cattgtaaagatggcgttacaattcgaattaagaagcaaattccagtcgcggccggattg
ggcggtggctcttcagatgcagcggcagttttacgcgcattaaatagtatttggcggttg
ggcttgagtttatcagaactggcaaagattgcattaacaattgattctgacgtcccgtat
tgtatatataacaaattagcccacgttactggccatggtgaaaaaatcgaattgttacca
ccgcaacctcattattgggctgtgattgcaaaacagaagatcagtgtttctacgccgcaa
atcttacgacaaattaattatgagaagcttcaacatcttaataatgaagcattactgaca
aatttaaagaaagaagattggcaagaagcaacaaaatatatgggaaatgttttagagccc
ttaacgatgaaattttatccagagattggtcgtctaaagaataagatgaaagaattgggg
gccgatgttgcccagatgagtgggacgggaccaaccgtcttcgcaatctgccatacagaa
tcgcgagcaaaacggattcaaaatagtatccggggattttgtcgcgacgttcatgttgta
actttgctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system