KEGG   Lactobacillus reuteri JCM 1112: LAR_0237Help
Entry
LAR_0237          CDS       T00735                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lrf00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lrf00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:lrf00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
282115..283029
Genome map
AA seq 304 aa AA seqDB search
MQKLEQLIDKNFAETAHGKVANYIPILGIVDPQQLGIAIYDVDEDEIGTAGMAGTRFAIE
SIAKVITLILTIKRLGHKRVLAELENGSADYSLSSVLLDDELTEQVHRVNYLNNSSALLT
TALIDQLMGQNSFNALLGFCREICNDPCISLNERLFRSAIMNDKDIHALAYYMKDKDILE
TVDQTLITYFMQSSMMVTSQSLANLGAVLANDGIKPWDNERLISHEDNELVKKLLTTVGS
FEESKEYTIKIELPIKSGTGGGLLACAPQKCGIGIFSPALDQHGNSLAGMSLLQDVVDQL
ELVV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattagagcaattgattgataaaaactttgctgaaacagctcatggtaaggtt
gcaaactatattccgatattaggaattgttgatccgcaacaactgggcattgccatttat
gacgttgacgaggacgaaattgggaccgctggaatggcaggaacgcgatttgcgatcgag
agtattgcgaaggtcataactttaatattaacgatcaagagattaggacataagcgcgtc
ttagcagaactagaaaatggttcggcagattatagcctaagttcggtactattggatgac
gagttaaccgagcaggtccaccgggtaaattaccttaataattcctccgctttgttaacg
acagccttaattgaccagttgatggggcagaatagttttaatgcccttctcggtttctgc
cgtgagatctgcaatgacccatgcattagcttgaatgagcgtttatttcggtcagcaatt
atgaatgataaagatattcatgcactggcttactatatgaaagataaagatattttagag
actgttgatcaaacattgataacttattttatgcaaagctcaatgatggtgacatcacag
agtcttgctaacctaggagcagtcttggcaaatgatggaattaaaccttgggataatgag
cgtcttattagccatgaagataacgagttggtaaagaaattgctaacaacagttggttcg
tttgaagaatcaaaagaatacacaattaaaattgaactccctattaaaagtggtactggc
ggcggcttattggcttgtgccccgcaaaaatgtggtattggtatttttagtccagctctt
gatcaacatggcaatagtttggcaggaatgagtttattacaagatgttgttgatcaatta
gaattagtagtttaa

DBGET integrated database retrieval system