KEGG   Lactobacillus reuteri JCM 1112: LAR_0277Help
Entry
LAR_0277          CDS       T00735                                 

Definition
beta-galactosidase small subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAR_0277
  Lipid metabolism
   00600 Sphingolipid metabolism
    LAR_0277
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LAR_0277
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LAR_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337156..338115
Genome map
AA seq 319 aa AA seqDB search
MAYTNKLRVIYGDATLGLSGDSFHYIFSYERGGLESLKLNGKEWLYREPMPTFWRATTDN
DRGSGFNIRSAQWLAADTFHKCVGIDLTVDNQHFAELPIAPITNEFSDPVSAENVKIKYT
FETLTVPATQVTVTYEVNRQGEIKVTMHYYGHEDLPGLPVVGMRFIMPTVATGFDYQGLS
GETYPDRMAGATEGTFHVDGLPVTKYLVPQENGMHMDTHALTITRDSTQNNADHSREPFN
LTIKQDEQPFAFSCLPYTAEELENATHIEELPLARRTVLVVAGAVRGVGGIDSWGADVEE
QYHIPADRDVEFSFVLNAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaataaattacgcgtgatatatggtgatgcgacattaggacttagtggt
gacagctttcattatatttttagctatgagcgtggtggattagaatcgcttaagctaaac
ggtaaagaatggctatatcgtgaaccaatgccgacgttttggcgggcaaccactgataat
gaccgaggaagtggctttaatattcggtctgctcagtggttagcagcggacacttttcat
aagtgtgttgggattgacctgacagttgataatcaacactttgccgaattacctattgcg
ccgataaccaatgaatttagtgatccggtatctgctgaaaacgtcaaaattaagtatact
tttgagacgctaacagttccggccacgcaagtcactgtaacttatgaggttaacagacaa
ggtgagattaaagtgacaatgcactattacggccatgaagacttacctggtctaccagta
gtaggaatgcgttttatcatgccaacagttgctaccggctttgactatcaaggattatcc
ggtgaaacttaccccgaccggatggcaggagcgactgagggtaccttccatgttgacggt
ttaccggttactaagtatctcgttccccaggaaaatggaatgcacatggatactcatgca
ttaacaattacccgcgattccactcaaaataatgctgatcattcgcgggaaccatttaac
ttaactattaagcaagacgagcaaccgtttgccttcagttgtttaccatatacagcggag
gaattagaaaatgcaacacacatcgaagagctcccactcgcacgacgaactgttctcgtt
gttgcgggggcggtccgcggtgttgggggaattgatagttggggtgcagatgttgaagaa
cagtatcatattcctgccgaccgtgatgttgagttttcgtttgtattgaatgcaaaataa

DBGET integrated database retrieval system