KEGG   Lactobacillus reuteri JCM 1112: LAR_0279Help
Entry
LAR_0279          CDS       T00735                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAR_0279
   01230 Biosynthesis of amino acids
    LAR_0279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_0279
  Energy metabolism
   00680 Methane metabolism
    LAR_0279
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAR_0279
Enzymes [BR:lrf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAR_0279
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAR_0279
  Exosomal proteins of melanoma cells
   LAR_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340095..340862
Genome map
AA seq 255 aa AA seqDB search
MLSTSKMRYYKIVAKGSEKMAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGK
ELLRLGIQFSDAYTSYMERAIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEV
KKEIGAEQLHKWRRGFKDLPPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHI
APRLIDGHNQLIVAHGSSLRALIKYLDGISDDDIDKVEVPNGKPILYRFDDHLNVIKKTF
ITMDGEIDDNTRISK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgttaagcactagtaaaatgcgctattataagatagtggcaaaggggagtgaaaaaatg
gcagaattagtaattgtacgtcatgggcaaagtcaagctaaccgtgataatatttttact
ggctggactgatgttccgttgactcctaaaggaattgaacaaggtgaattagtcggcaag
gaattgctaagactaggtatccaatttagtgatgcgtatacgtcctacatggaacgggca
atcatgacaactaatattatcctagaagaaattaatcagttatatattccggttcataaa
acgtggcgactaaacgaacgtcattatggagcattgagtggtcggaacaaagatgaagtg
aagaaagagattggtgcagaacagcttcataaatggcggcgtggttttaaagatttacca
ccacaattaaaagagcgtcagcatgatcgccgctatgatcgcttaggagttaagattccg
cttagtgagagtttagaaatgacgctccaacgactcctcccatattggcaagaccatatt
gcgcctcgtttaattgacggacacaatcagttaattgttgcccatggtagttctttgcgg
gcactaattaaatatttagatggtatttcagatgacgatattgataaagtggaagttcca
aatggcaagccaattttatatcgctttgatgatcatcttaatgtcattaaaaagactttt
ataacaatggatggtgaaattgatgacaatacacgaattagcaaataa

DBGET integrated database retrieval system