KEGG   Lactobacillus reuteri JCM 1112: LAR_0317Help
Entry
LAR_0317          CDS       T00735                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LAR_0317 (recR)
DNA repair and recombination proteins [BR:lrf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LAR_0317 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375028..375630
Genome map
AA seq 200 aa AA seqDB search
MIQYPEPLAKLIESYTKLPGIGQKTATRLAFYTLSMQEDDVTNFAKSLLSAKRDLHNCSI
CGNITEDDPCPICRDKTRDHSQILVVEQSQDVMAMERMHEYHGLYHVLHGVISPVAGTGP
EDINITSLLKRLKKDDEVKEIIIATNASSDGELTAGYLAKLIKPAGIKVTRLAHGLSVGA
DIDYADEMTLFKAVQGRTEM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatccaatatccagaaccattagcgaaattaattgaaagctatactaagttgccagga
atcgggcaaaagactgcaacgcggctggcgttctatactctgagtatgcaagaagatgat
gtgacaaactttgctaaatcccttctgtctgctaaaagggaccttcataactgtagtatt
tgtggcaatattaccgaagacgacccttgtccaatttgtcgcgataagacccgtgatcat
tcgcaaattctagttgttgagcagtcacaagacgttatggcaatggaacggatgcatgaa
taccatggtttataccatgtccttcatggagttatttctccagttgcaggaacaggccca
gaagatattaatattacaagtttacttaaacgactaaagaaagatgatgaagtaaaggaa
attattattgcaacgaatgcttcatctgatggtgagttgacggccggttacctcgctaag
ttaattaagcctgcgggaattaaagttactcggttggcgcatgggttatcagttggcgct
gatattgactatgctgatgagatgacattattcaaagcagtgcaagggcgaacggagatg
taa

DBGET integrated database retrieval system