KEGG   Lactobacillus reuteri JCM 1112: LAR_0361Help
Entry
LAR_0361          CDS       T00735                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LAR_0361
   00052 Galactose metabolism
    LAR_0361
   00500 Starch and sucrose metabolism
    LAR_0361
   00520 Amino sugar and nucleotide sugar metabolism
    LAR_0361
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LAR_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420471..421385
Genome map
AA seq 304 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKN
KRSIEDHFDSNPELEDNLRSKHKDEMLKMVEETTDVNIYFIRQSHPRGLGDAVLTARDFI
GDEPFVVMLGDDLNNINNKNEALTKQLIESYNQTGASTLAVMRVPHEDTAKYGVINPSKE
VTPGLYNVTSFVEKPAPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGGEIQLTDAIDTL
NQTQRVFAREYKGDRYDVGNKFGWVKTNIEYGLEHPQVKEELREYIKELGAKLAAEDKQN
NSKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgttagaaaagccattattcctgctgccggtttaggaactcgttttcttcct
gcaacaaaggcattggcaaaggaaatgttaccaattgttgataagccaacaattcaattt
attgttgaagaagcgcgcaaatcaggaattgaagatattgttgttgttgatggaaagaat
aagcggtcgattgaagaccattttgactctaatccagagttggaagataatcttcgttca
aaacacaaggatgagatgttaaagatggttgaagaaacaaccgatgttaatatttacttc
attcgtcaatctcatcctcgtggtttaggggacgctgttttaactgctcgtgattttatc
ggggatgaaccatttgttgttatgcttggggatgaccttaataacattaacaacaagaat
gaagctttaacaaagcaattgattgaaagttataaccaaactggcgcatctactcttgct
gttatgcgggttccacatgaagatactgcaaagtatggtgtaattaatcctagcaaggaa
gttacgccaggtctctataacgtaactagcttcgttgaaaagccagctcctaaagatgcc
ccaagtgatttagcaattattggtcggtatgtctttactccagaaatctttgacgtattg
gcaaagactaagccaggtaagggcggcgaaattcaattaactgatgcaattgatactctg
aaccaaactcaacgggtattcgctcgtgaatacaagggtgaccgttacgatgttggtaat
aagtttggctgggttaagacaaacattgaatatggtttggaacacccacaagttaaagaa
gaattgcgtgaatacattaaggaattaggcgcaaaacttgctgctgaagataagcaaaat
aattctaagaagtaa

DBGET integrated database retrieval system