KEGG   Lactobacillus reuteri JCM 1112: LAR_0388Help
Entry
LAR_0388          CDS       T00735                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Brite
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LAR_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455102..455878
Genome map
AA seq 258 aa AA seqDB search
MITYTGESFFFPHSGRRGVILLHAYTGNTNDVRMLGRQLNWQGYTVFAPLLSGHGGDPRK
VLESNGPGDWWDDTRMAIFRLRDAGIDQIAIFGLSLGGLLATRALENDPQLLGGGVFASP
ITTWGQSNVPEYFPKIAAEYYRRQKITPLITKEKVAKLTERLPKQLAQIQTMAHQICDQL
DQIHQPFFIAQGGADEMIDPVSGLQLKARLQANGVVVDYHYYPTATHLLTVNTAHRQLFA
DVEKYLQNLFEVSSNDNK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgataacgtatactggtgagtcttttttctttccccatagtggacgtcgtggagttatt
ttgcttcatgcatatacaggaaatacgaatgatgttcgaatgttaggacgtcagcttaat
tggcaagggtatacagttttcgcaccgcttttgagtgggcatggcggtgatccgcgaaaa
gtactagaaagcaatggtccaggtgattggtgggatgatacccggatggcaatctttcgt
ttacgcgatgctggaattgatcaaattgcgatttttggtttatcgctcggtggtttactt
gccaccagggctcttgagaatgatccgcaattattaggtggtggtgtttttgcatcccca
attaccacctggggacaatcaaatgttccggaatactttcctaaaattgcggcagagtat
tatcgtcgacaaaaaattacccccttaattactaaggaaaaggttgctaaattgactgaa
cgactccccaaacaactagcacaaattcaaacaatggcgcatcaaatttgtgaccaatta
gatcagattcatcaacctttctttattgcacagggaggcgcggatgaaatgattgatcca
gtgtctggcctgcaattaaaagcaagattacaagcaaatggggttgtagttgattatcat
tactacccaaccgctactcacttattaacagttaataccgctcatcgtcaattatttgcc
gatgtagaaaaatatttacaaaatttattcgaggtgtcttctaatgacaacaaataa

DBGET integrated database retrieval system