KEGG   Lactobacillus reuteri JCM 1112: LAR_0452Help
Entry
LAR_0452          CDS       T00735                                 

Definition
ATP synthase C subunit
Orthology
K02110  
F-type H+-transporting ATPase subunit c
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    LAR_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526022..526240
Genome map
AA seq 72 aa AA seqDB search
MALGAIAAGLAAMGAAIGGGIGDGILIGHTVDSIARQPELQSRLQATMFIGVGLIEAMPI
IAIVIGFLVMNK
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggcattaggagcaattgctgcaggactcgcggctatgggtgccgctatcggtggtggt
atcggtgacggtatcttaatcggacacacagttgacagtatcgcacgtcaaccagaatta
caaagtagattacaagcaacgatgtttattggtgttggtttgattgaagccatgcctatt
attgccatcgttattggcttccttgttatgaacaagtaa

DBGET integrated database retrieval system