KEGG   Lactobacillus reuteri JCM 1112: LAR_0459Help
Entry
LAR_0459          CDS       T00735                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LAR_0459
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LAR_0459
Enzymes [BR:lrf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LAR_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532259..533575
Genome map
AA seq 438 aa AA seqDB search
MEKIVVRGGQRLTGRVKVEGAKNAVLPIQAASILASSGNIKLSNVPILSDVTTMNQLLRF
LNIKVDFDKDKHVLTIDAADPVSSEAPLEYVSRMRASMVVLGPLLARTGHAQIALPGGCA
IGSRPIDLHLKGLRQLGAIIEQHDGYLEARAEHLIGDHIYLDFPSVGATQNLMMAATLAQ
GITTIENAASEPEIVDLANLLNKMGARVHGAGTDIIRIQGVNFLHGCEHTVMPDRIEAGT
FMIATAITNGDVVVEGAIAEHNTSLIAKLEEMGVTVIVQEDGIRVLGTSVLIPTNIKTLP
YPGFPTDLQPQMSILQLLANGTSTLDETIFEKRFMHLEELRRMNADFQINGPVAVLNGPT
HFSGAEVAASDLRAGAALVLAGLVADGITQVRNLKYIDRGYYHLHQKLQQLGAKIDRIDV
EDKIKLAVKPSKNKTNQD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattgttgttaggggcggtcagaggttaaccggtcgagttaaagttgaagga
gcaaaaaatgcagtcttaccaattcaagcagcatctattttagcttctagcggaaacatt
aaattatcaaatgttccaattttatcggatgtaacgacaatgaatcagttattacggttc
ttaaatataaaagtagattttgataaggataagcacgttttgacaattgatgcggctgat
cctgtatcatctgaagcaccattagaatatgttagccggatgcgggcatcgatggtagtc
ttaggacccttgctagctcggacagggcatgcgcaaattgcgcttcctggtggatgtgcg
attggatcccggccaattgacttacatcttaaaggattacgtcaattaggagcaattatt
gagcaacacgatggatacttagaggcacgggctgaacacttaattggtgatcacatttat
ttagatttccctagtgtcggtgcaacgcaaaatctgatgatggcagcaacacttgcgcaa
ggaattacaacaattgaaaatgctgctagtgagcctgaaattgttgatttagcaaacctg
ttgaataaaatgggtgcacgtgtccatggcgctggaacagacattatccggattcaaggg
gttaatttccttcatggttgtgaacatacagtaatgccggacaggattgaagcggggaca
ttcatgattgcgacagccattactaatggtgacgtcgtggttgaaggggcaattgctgag
cataacacctcattgattgctaagttggaggaaatgggtgtgacagtcatcgttcaagaa
gatgggattcgtgttctggggacttcggttttaattcctacgaatattaagactctccca
tatccaggtttccctactgatcttcaaccacaaatgtccattctccagcttttggcaaat
gggaccagtaccctagatgagacgatttttgagaagcgttttatgcatttagaagaatta
cgacgaatgaacgctgattttcaaattaatggtccagttgcggttttaaatggtcctacg
cattttagtggcgctgaagtagctgcctctgatttacgagcgggggctgctttagtattg
gccgggttagttgctgatggaattacccaggttcgtaacctaaaatatattgatcgggga
tattaccatcttcaccaaaagttacaacaattaggggctaagattgatcgaattgatgtc
gaggataaaattaaattggcggtaaagccttctaagaataaaacaaatcaagattaa

DBGET integrated database retrieval system