KEGG   Lactobacillus reuteri JCM 1112: LAR_0459Help
Entry
LAR_0459          CDS       T00735                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lrf00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lrf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532259..533575
Genome map
AA seq 438 aa AA seqDB search
MEKIVVRGGQRLTGRVKVEGAKNAVLPIQAASILASSGNIKLSNVPILSDVTTMNQLLRF
LNIKVDFDKDKHVLTIDAADPVSSEAPLEYVSRMRASMVVLGPLLARTGHAQIALPGGCA
IGSRPIDLHLKGLRQLGAIIEQHDGYLEARAEHLIGDHIYLDFPSVGATQNLMMAATLAQ
GITTIENAASEPEIVDLANLLNKMGARVHGAGTDIIRIQGVNFLHGCEHTVMPDRIEAGT
FMIATAITNGDVVVEGAIAEHNTSLIAKLEEMGVTVIVQEDGIRVLGTSVLIPTNIKTLP
YPGFPTDLQPQMSILQLLANGTSTLDETIFEKRFMHLEELRRMNADFQINGPVAVLNGPT
HFSGAEVAASDLRAGAALVLAGLVADGITQVRNLKYIDRGYYHLHQKLQQLGAKIDRIDV
EDKIKLAVKPSKNKTNQD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattgttgttaggggcggtcagaggttaaccggtcgagttaaagttgaagga
gcaaaaaatgcagtcttaccaattcaagcagcatctattttagcttctagcggaaacatt
aaattatcaaatgttccaattttatcggatgtaacgacaatgaatcagttattacggttc
ttaaatataaaagtagattttgataaggataagcacgttttgacaattgatgcggctgat
cctgtatcatctgaagcaccattagaatatgttagccggatgcgggcatcgatggtagtc
ttaggacccttgctagctcggacagggcatgcgcaaattgcgcttcctggtggatgtgcg
attggatcccggccaattgacttacatcttaaaggattacgtcaattaggagcaattatt
gagcaacacgatggatacttagaggcacgggctgaacacttaattggtgatcacatttat
ttagatttccctagtgtcggtgcaacgcaaaatctgatgatggcagcaacacttgcgcaa
ggaattacaacaattgaaaatgctgctagtgagcctgaaattgttgatttagcaaacctg
ttgaataaaatgggtgcacgtgtccatggcgctggaacagacattatccggattcaaggg
gttaatttccttcatggttgtgaacatacagtaatgccggacaggattgaagcggggaca
ttcatgattgcgacagccattactaatggtgacgtcgtggttgaaggggcaattgctgag
cataacacctcattgattgctaagttggaggaaatgggtgtgacagtcatcgttcaagaa
gatgggattcgtgttctggggacttcggttttaattcctacgaatattaagactctccca
tatccaggtttccctactgatcttcaaccacaaatgtccattctccagcttttggcaaat
gggaccagtaccctagatgagacgatttttgagaagcgttttatgcatttagaagaatta
cgacgaatgaacgctgattttcaaattaatggtccagttgcggttttaaatggtcctacg
cattttagtggcgctgaagtagctgcctctgatttacgagcgggggctgctttagtattg
gccgggttagttgctgatggaattacccaggttcgtaacctaaaatatattgatcgggga
tattaccatcttcaccaaaagttacaacaattaggggctaagattgatcgaattgatgtc
gaggataaaattaaattggcggtaaagccttctaagaataaaacaaatcaagattaa

DBGET integrated database retrieval system