KEGG   Lactobacillus reuteri JCM 1112: LAR_0588Help
Entry
LAR_0588          CDS       T00735                                 

Definition
(GenBank) exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LAR_0588
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LAR_0588
DNA repair and recombination proteins [BR:lrf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LAR_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA AAA_22 T2SSE Sigma54_activ_2 AAA_29 DUF815 NB-ARC UvrD-helicase RsgA_GTPase AAA_14 AAA_25 DEAD TsaE HTH_IclR AAA_12 Zeta_toxin NTPase_1 AAA_28 AAA_16 HHH_5 AAA_18 UvrD_C AAA_17 AAA_23
Motif
Other DBs
NCBI-ProteinID: BAG25104
Position
685346..687832
Genome map
AA seq 828 aa AA seqDB search
MTSMAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANFDWHEPEITVTGS
FGDLSDDQTYRFEGKIVEHPRYGQQFQATSYHVNRPTSKDGLIDFLSGKQFTGIGKKTAE
KIVDKLGTDAINKIIADPHVLDELKLRKAVKDSLVDNLRAHQGMDQIIIGLNDLGFGANL
SSAIFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIATDDSRRIDAAIIQTL
DDLTMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIVELEKNQAISYADEKIYP
TALYNAEWQIADHLHRLLTVDQEKVPATTIEKTVTKVADQSGITYDQVQKEAIKTALNSK
VMLLTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFPVLLAAPTGRAAKRMSEAT
DLPASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVDTLLFKTLIQAVPTSMHVVL
VGDKDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADSTIIPLAHAIKEGKLPSDLTN
KMPDRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQILAPMYRGQAGIDRLNELAQQAY
NPPANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGDIGKITAIESGRTVGKKNESITV
DFDGNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVLLPIVQQFSRMLQRNLLYTAITRA
AEKLVLIGEPYAAVTSVKNEAVNRKTSLVDRLGRVWNRHGELKSNLDHQTDSLTKELASS
QPVQKQTEQLINNDAQQYILTADLINSDTIDPLIGMENISLQSLHQVK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgacttctatggctgaagaaatcgacctatttaagacgccaacggagccgtcttttttt
attggtcaggtacaatctgagatttttactagtccagattcgttttttaaggttttaatt
gtctcggttgaagaagcaaattttgattggcacgagccggagattactgtaacgggaagt
tttggtgatcttagtgatgatcagacttaccgctttgagggaaaaattgttgagcatccg
cgatatgggcaacagtttcaagcgacttcttaccatgtcaatcggcccacaagcaaggat
gggttaattgatttcttgtctggaaaacagtttaccggaattggaaaaaagacggctgaa
aaaattgtcgataaattaggaacggatgcgattaataaaattattgctgacccccatgtt
ttagatgaattaaaactccgcaaagcagttaaggattcattagttgataatttacgagca
caccaggggatggaccagattattatcggcctaaatgatctcggctttggcgctaacctt
agtagtgcaatttttgacaagtacggagaagaaactctgcatattattaatgaaaatcct
taccaactcgctgctgagatagatggaattagctttaatcgggctgatcaggtggcacag
aaattaggaatcgccacggatgattcacgtcgaattgatgccgcaattatccagacgctt
gatgacttgacaatggagactggtgatacatttactacaacaaaacctcttctgcagcaa
actatccagttgcttgcccaaggaagtgggggtcgtgtttcgaccgatttaattgccaac
caaattgttgagctagagaaaaatcaagcaattagttatgcggatgaaaaaatttatcca
actgccctttataacgcggaatggcaaattgctgatcacttacatcgtcttcttaccgtt
gaccaggaaaaagtaccagcaacgactattgagaaaacagttacgaaggttgccgatcaa
tcggggataacctatgaccaagttcaaaaagaggccatcaaaacagccttaaatagtaaa
gttatgcttcttacgggaggcccaggaacgggaaaaacaacaattattaaagggattgta
gcaagttatgcgaaaattcatgatctttcattggacgtaaatgaatataaagaaaagtca
tttcctgttttactagctgctcctacaggccgtgctgctaaacgaatgagtgaagctact
gatttaccagcaagtacaattcaccgcttgctagggcttaatggccgggaaatgccaact
gatatgaatgcccgcgatttagaaggctcgttattgattattgatgaaatgtcgatggtc
gataccctcttgtttaagactcttattcaagccgtccctacttctatgcatgtagttttg
gtaggtgataaagaccaattaccatctgttggtcccgggcaagttttccatgatcttctt
gactttgcagaactgcccaaagttgaactgaccaatattcaccgccaggctgctgattca
acaattatcccattagctcatgctatcaaagagggtaagctaccatcagatctaacgaat
aaaatgccagatcgatcatttatctcatgccatgctaaccaagtgccaagtgtggttcaa
caaattattgacctttctaaaaaacgagattattccgcaaatgatattcaaatcttggca
ccaatgtaccgtggacaggcagggatcgatcgtttgaatgagcttgcacaacaggcgtat
aatcctccagctaatggaaagcaagaagtcgattttaggggactaacttttcgtgttgga
gataaggttctgcaactcgttaatgttccagaaaagaacatttttaatggtgacattgga
aaaatcacagcaattgaaagcggtaggacagtcggtaagaaaaatgaatcaattactgtc
gattttgatggtaatgaagtgagttatagccgcatggaatggaatcaattacggttagct
tattgtatttcgatccataaagcacagggaagtcagtttaagatggttcttttgccaatt
gttcagcagtttagccggatgcttcaacgaaatcttttatatacagcgattactcgtgcc
gcagaaaagctagttttgatcggtgagccatatgcggctgtgactagtgtaaaaaatgaa
gcagttaaccgaaaaacttctttggttgatcgcctcggtagggtttggaataggcatggt
gaactaaaatcaaacttagatcatcaaacagattcattaacaaaagaacttgctagttcc
caaccagttcaaaaacaaactgaacaattaataaataatgatgctcagcaatatattcta
acagctgatctcattaattcagatacaattgatccattaatcggaatggaaaatattagc
ttacaaagtttgcatcaagtcaaataa

DBGET integrated database retrieval system