KEGG   Lactobacillus reuteri JCM 1112: LAR_0588Help
Entry
LAR_0588          CDS       T00735                                 

Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LAR_0588
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LAR_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685346..687832
Genome map
AA seq 828 aa AA seqDB search
MTSMAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANFDWHEPEITVTGS
FGDLSDDQTYRFEGKIVEHPRYGQQFQATSYHVNRPTSKDGLIDFLSGKQFTGIGKKTAE
KIVDKLGTDAINKIIADPHVLDELKLRKAVKDSLVDNLRAHQGMDQIIIGLNDLGFGANL
SSAIFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIATDDSRRIDAAIIQTL
DDLTMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIVELEKNQAISYADEKIYP
TALYNAEWQIADHLHRLLTVDQEKVPATTIEKTVTKVADQSGITYDQVQKEAIKTALNSK
VMLLTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFPVLLAAPTGRAAKRMSEAT
DLPASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVDTLLFKTLIQAVPTSMHVVL
VGDKDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADSTIIPLAHAIKEGKLPSDLTN
KMPDRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQILAPMYRGQAGIDRLNELAQQAY
NPPANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGDIGKITAIESGRTVGKKNESITV
DFDGNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVLLPIVQQFSRMLQRNLLYTAITRA
AEKLVLIGEPYAAVTSVKNEAVNRKTSLVDRLGRVWNRHGELKSNLDHQTDSLTKELASS
QPVQKQTEQLINNDAQQYILTADLINSDTIDPLIGMENISLQSLHQVK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgacttctatggctgaagaaatcgacctatttaagacgccaacggagccgtcttttttt
attggtcaggtacaatctgagatttttactagtccagattcgttttttaaggttttaatt
gtctcggttgaagaagcaaattttgattggcacgagccggagattactgtaacgggaagt
tttggtgatcttagtgatgatcagacttaccgctttgagggaaaaattgttgagcatccg
cgatatgggcaacagtttcaagcgacttcttaccatgtcaatcggcccacaagcaaggat
gggttaattgatttcttgtctggaaaacagtttaccggaattggaaaaaagacggctgaa
aaaattgtcgataaattaggaacggatgcgattaataaaattattgctgacccccatgtt
ttagatgaattaaaactccgcaaagcagttaaggattcattagttgataatttacgagca
caccaggggatggaccagattattatcggcctaaatgatctcggctttggcgctaacctt
agtagtgcaatttttgacaagtacggagaagaaactctgcatattattaatgaaaatcct
taccaactcgctgctgagatagatggaattagctttaatcgggctgatcaggtggcacag
aaattaggaatcgccacggatgattcacgtcgaattgatgccgcaattatccagacgctt
gatgacttgacaatggagactggtgatacatttactacaacaaaacctcttctgcagcaa
actatccagttgcttgcccaaggaagtgggggtcgtgtttcgaccgatttaattgccaac
caaattgttgagctagagaaaaatcaagcaattagttatgcggatgaaaaaatttatcca
actgccctttataacgcggaatggcaaattgctgatcacttacatcgtcttcttaccgtt
gaccaggaaaaagtaccagcaacgactattgagaaaacagttacgaaggttgccgatcaa
tcggggataacctatgaccaagttcaaaaagaggccatcaaaacagccttaaatagtaaa
gttatgcttcttacgggaggcccaggaacgggaaaaacaacaattattaaagggattgta
gcaagttatgcgaaaattcatgatctttcattggacgtaaatgaatataaagaaaagtca
tttcctgttttactagctgctcctacaggccgtgctgctaaacgaatgagtgaagctact
gatttaccagcaagtacaattcaccgcttgctagggcttaatggccgggaaatgccaact
gatatgaatgcccgcgatttagaaggctcgttattgattattgatgaaatgtcgatggtc
gataccctcttgtttaagactcttattcaagccgtccctacttctatgcatgtagttttg
gtaggtgataaagaccaattaccatctgttggtcccgggcaagttttccatgatcttctt
gactttgcagaactgcccaaagttgaactgaccaatattcaccgccaggctgctgattca
acaattatcccattagctcatgctatcaaagagggtaagctaccatcagatctaacgaat
aaaatgccagatcgatcatttatctcatgccatgctaaccaagtgccaagtgtggttcaa
caaattattgacctttctaaaaaacgagattattccgcaaatgatattcaaatcttggca
ccaatgtaccgtggacaggcagggatcgatcgtttgaatgagcttgcacaacaggcgtat
aatcctccagctaatggaaagcaagaagtcgattttaggggactaacttttcgtgttgga
gataaggttctgcaactcgttaatgttccagaaaagaacatttttaatggtgacattgga
aaaatcacagcaattgaaagcggtaggacagtcggtaagaaaaatgaatcaattactgtc
gattttgatggtaatgaagtgagttatagccgcatggaatggaatcaattacggttagct
tattgtatttcgatccataaagcacagggaagtcagtttaagatggttcttttgccaatt
gttcagcagtttagccggatgcttcaacgaaatcttttatatacagcgattactcgtgcc
gcagaaaagctagttttgatcggtgagccatatgcggctgtgactagtgtaaaaaatgaa
gcagttaaccgaaaaacttctttggttgatcgcctcggtagggtttggaataggcatggt
gaactaaaatcaaacttagatcatcaaacagattcattaacaaaagaacttgctagttcc
caaccagttcaaaaacaaactgaacaattaataaataatgatgctcagcaatatattcta
acagctgatctcattaattcagatacaattgatccattaatcggaatggaaaatattagc
ttacaaagtttgcatcaagtcaaataa

DBGET integrated database retrieval system