KEGG   Lactobacillus reuteri JCM 1112: LAR_0610Help
Entry
LAR_0610          CDS       T00735                                 

Definition
pyruvate dehydrogenase complex E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lrf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lrf00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lrf00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lrf00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
710711..712045
Genome map
AA seq 444 aa AA seqDB search
MAYIFRLPEMGEGLTEGDVASWLIKEGEAIKADDPLIEIQTDKSTTQLVSPVDGTVKKLF
VKEDDHVEKGDKLAEIDDGKPGISTNVESEDDDDETDTGSEEATESEESTAPAADSPSED
NSSKGRVAPLAEPNKLVMAMPSVRQYARDKGVDISLVQPSGNHGQVLKEDIDNFNGAAAP
AKEEKSAATSAKTAPVAAKTAGNTIKPWNADLEEREPMSNMRKIIAKTTRESKDISPHVT
SFDEVEVSALMASRKKYKAVAAEQDIHLTFLPYIVKALVATCKKFPELNASIDDSTQEIV
YKHYYNVGILTNTDHGLYNPNIKNADSKSMFEIAKEITENTQAAFDNKLSPESMAGRTIS
ISNIGSIGGGWFTPVINQPDVAILGVGRIDKEPYVNEDGEIVVGRMMKLSLTYDHRLIDG
GLAQHALNYMNKLLHDPELLMMEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcatacatttttagactaccagaaatgggagaaggattaactgaaggtgatgttgct
tcttggctcattaaagaaggagaagcaattaaagctgatgatcctttaattgaaattcaa
actgataaatcaactactcaattggtatctccagttgatggaactgtcaaaaaattattt
gtaaaagaagacgaccatgttgaaaaaggcgacaagctcgctgaaattgatgatggtaag
cctggtattagtacaaacgtcgaaagtgaagacgatgatgatgaaactgatacaggcagt
gaagaagctactgaaagtgaagaatccacggctccagctgcagattccccttcagaagat
aattcttcaaaaggtagagtagccccacttgcagaaccaaataagcttgtaatggcaatg
ccttctgttcgtcaatatgcccgtgataagggtgttgatatttcacttgttcaaccaagt
ggtaaccacggtcaagttcttaaagaggatattgataactttaatggggcagctgctcca
gctaaggaagaaaagagtgcggctacgtcagctaagactgctcctgttgcggctaagacc
gctggtaatacaatcaagccatggaatgctgaccttgaagaacgtgaaccaatgtctaat
atgcggaagattatcgctaagactactcgtgaatcaaaggatatctcaccacatgttaca
tcatttgatgaagttgaagtatctgctctaatggctagtcgcaagaagtacaaggcagtt
gctgcagaacaagatattcacttgactttcttgccatacattgttaaggccttagttgcc
acatgcaagaagttcccagaactaaatgcttcaattgatgattctactcaagaaattgtt
tacaagcactactacaatgttgggatccttacaaacactgaccacggtctctataatcca
aatattaagaatgcagattctaagagcatgtttgagattgcaaaagaaattactgaaaat
actcaggcagcctttgataacaagctaagtccagaatcaatggctggtcggactatcagt
atcagtaatattggttcaattggcggtggctggttcacccctgttatcaaccaaccagat
gttgctattcttggtgttggtcgaattgacaaggaaccatacgttaacgaagatggtgaa
attgttgttggtcgaatgatgaagttatcattgacttacgatcaccgtttaattgatggt
ggacttgcacaacatgcattgaactacatgaacaagttattacatgatccagaattattg
atgatggagggctag

DBGET integrated database retrieval system