KEGG   Lactobacillus reuteri JCM 1112: LAR_0740Help
Entry
LAR_0740          CDS       T00735                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lrf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lrf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
853517..854005
Genome map
AA seq 162 aa AA seqDB search
MSELNLIWAEDLNGWIGKDNTIPWHVSADMKHFKTKTTGHPIIMGRRTFASLGNKPLPKR
ENIVLTSRNIDAEGVEVVHSLAALKEYLKANPNEYFVIGGATIYQQLLPMATKLTRTVIN
KQIVGDTKMPTIDYDRWHLVNHNNYEKDDQLICRFEEWELNV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctgaatttaatctgggccgaagatttaaatggctggattggcaaagataat
acaattccatggcatgtttctgctgatatgaagcattttaagacaaagactactggtcac
ccaattataatggggcgaagaacttttgcctcacttggcaataaaccgttgcctaagcgg
gaaaatattgtgcttaccagtaggaacatagatgctgaaggagtggaagtcgttcattct
ttagctgcccttaaagaatatcttaaagcaaatccaaacgaatattttgtaatcggtggg
gcaacgatctatcagcaattacttccaatggcgacaaagctaacacgaacggtgataaat
aagcaaattgttggagatacaaaaatgccaacgatcgattatgaccgttggcacttagta
aatcacaataattatgaaaaagatgaccagctaatttgtcgttttgaagaatgggaacta
aacgtataa

DBGET integrated database retrieval system