KEGG   Lactobacillus reuteri JCM 1112: LAR_0857Help
Entry
LAR_0857          CDS       T00735                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrf00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lrf00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lrf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974354..976543
Genome map
AA seq 729 aa AA seqDB search
MITFDEQQRVFHLKNKEISYLFSVEEGNILSHLYFGPAIRNYHGERRYPRVDRGFSGNLP
GSMDRTYSKDDLLQEYSGNNTGDYRVPAIIIKTENGSRLTDFRYKSYKILPGKPKLAGLP
ASYVKSDKEAETLEVILVDETIGAQLILSYTIYNERPVITRNARLVNTSNQELRIEKIAS
MQLDLTKHDYDVISVPGQYALERQPERQELRRGITEFSSRRNSSSHHMNPFVALVDKNTD
EFQGNALGVLLVYSGNHQFTLEKDQIDQIRLITGINDYDFEWVLEPGKDFQTPEAIMGFS
QQGLNGMSQVFHKLLRDRVARGKYQYADRPIVINNWEATFFDFDDKKLDQIIDEAKPLGI
EMFVLDDGWFGHRNDDNSSLGDWFVNQDKLTGGLKRVADRTHEHGMKFGLWFEPEMISVD
SKLYKEHPDYALHEPNRGMTLSRNQLVLDFSRKEVVDNIYNQMCLILDKVLLDYIKWDFN
RNLTEVFSSAADADHQGEISHRYVLGLYDLMERLVTRYPNILFEGCSGGGGRFDAGILYY
MPQSWPSDDTDAVERLKIQYGTSLTYPISSMTAHVSVSPNQQTGRSTSFKMRGDVAMSGV
FGYELDLADLTEEDRQMVKEQIKFYKAHRHLIQYGAFIRLESPFDSNTVAWEFVSPDKSE
ALLFMFKQLHTNRFEINNTKMAGLDPTIDYHDEMTDKTYGGDELMNVGLFRDPTHTGDFI
SEVHYFKGE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacagcaacgtgtttttcacttaaaaaataaagaaatttcctat
ttattttcagtagaagagggaaatatcctcagtcacctttattttggaccggcaattcgc
aactaccatggtgaacgtcgatatccacgagttgatcgtggattttcagggaaccttcct
gggtcgatggaccgaacttactctaaagatgatttgttgcaggagtattcaggaaacaat
accggagactatcgcgtgcctgcgattattatcaaaacagaaaatggttcacgactgact
gatttccgttacaagtcttataagattttaccggggaagcccaaactagctgggttacct
gcatcttatgttaaaagtgataaagaagcagaaacgttggaagttattttggttgatgaa
acaattggtgcgcaacttattctttcgtacactatctataacgaacggccggttattaca
aggaatgcgcggttagtaaacacaagcaatcaagaattacgaattgaaaagattgcctca
atgcaactagatttaactaaacatgattatgacgttatctccgttccaggccagtatgcc
cttgaacgacaacctgaacggcaagaattacgtcggggaataacagaattttctagccgt
cgaaattctagttctcatcatatgaacccgtttgtggccttggttgataagaataccgat
gaatttcaaggaaacgctttgggagtgctccttgtttactctggtaatcaccagtttacc
ttggaaaaagatcagattgaccagattcgcttaataaccggaattaatgattatgacttt
gaatgggttcttgaaccgggaaaagattttcagacaccggaagcaatcatgggctttagt
cagcagggcctaaatgggatgtcacaagtattccacaagttattacgggaccgggttgct
cgcggtaagtatcaatatgcagaccgcccaattgttattaataattgggaagcgaccttc
tttgactttgatgataagaagttagaccaaattattgatgaagcaaagccattgggaatt
gaaatgtttgttcttgatgacggctggtttggccaccggaatgatgataattcatcgctt
ggtgattggtttgttaaccaggataagcttactggtggattaaagcgggtagcagaccgg
acccacgagcatggcatgaaattcggcctctggtttgagccagaaatgatttcagtcgat
tctaagttatataaggaacatccagactatgccttacatgaaccgaaccgtggcatgaca
ctttctcgtaatcaattagtactagactttagccgtaaagaagtcgttgataatatttac
aatcaaatgtgcttaattttagataaggtgctgcttgactatattaaatgggacttcaac
cgtaatcttactgaagtcttctctagcgcagcggatgcagaccatcaaggagaaattagc
caccgttatgttttaggtttatatgacttaatggagcggttagttacccgttatcctaat
attttgtttgaaggctgctctggcggtggtggccgctttgatgctggtattctttactac
atgccgcaaagttggccatcagatgatacagacgcggtcgaacggttaaagatccaatac
ggaacatctttaacttatccaatctcatctatgacggcgcatgtatcagtttcacctaac
cagcaaactggtcgttctactagttttaagatgcggggcgatgttgccatgagcggggtc
tttggctatgaacttgacttagcagatttgactgaagaggatcggcaaatggtaaaggaa
cagatcaagttctacaaggctcaccgccacttaattcaatatggtgcctttattcgctta
gaaagtccttttgatagcaatacagtcgcttgggaatttgtcagtcctgataagtcagaa
gcgctgctatttatgtttaagcagttgcatactaaccgttttgaaattaataataccaag
atggcgggacttgatccaacaattgattatcatgatgagatgaccgataagacttatggt
ggggatgaattgatgaatgtcggtttgttccgtgacccgactcatacgggggacttcatt
tccgaagtgcattactttaaaggtgaatag

DBGET integrated database retrieval system