KEGG   Lactobacillus reuteri JCM 1112: LAR_0857Help
Entry
LAR_0857          CDS       T00735                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAR_0857
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAR_0857
   00600 Sphingolipid metabolism
    LAR_0857
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LAR_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974354..976543
Genome map
AA seq 729 aa AA seqDB search
MITFDEQQRVFHLKNKEISYLFSVEEGNILSHLYFGPAIRNYHGERRYPRVDRGFSGNLP
GSMDRTYSKDDLLQEYSGNNTGDYRVPAIIIKTENGSRLTDFRYKSYKILPGKPKLAGLP
ASYVKSDKEAETLEVILVDETIGAQLILSYTIYNERPVITRNARLVNTSNQELRIEKIAS
MQLDLTKHDYDVISVPGQYALERQPERQELRRGITEFSSRRNSSSHHMNPFVALVDKNTD
EFQGNALGVLLVYSGNHQFTLEKDQIDQIRLITGINDYDFEWVLEPGKDFQTPEAIMGFS
QQGLNGMSQVFHKLLRDRVARGKYQYADRPIVINNWEATFFDFDDKKLDQIIDEAKPLGI
EMFVLDDGWFGHRNDDNSSLGDWFVNQDKLTGGLKRVADRTHEHGMKFGLWFEPEMISVD
SKLYKEHPDYALHEPNRGMTLSRNQLVLDFSRKEVVDNIYNQMCLILDKVLLDYIKWDFN
RNLTEVFSSAADADHQGEISHRYVLGLYDLMERLVTRYPNILFEGCSGGGGRFDAGILYY
MPQSWPSDDTDAVERLKIQYGTSLTYPISSMTAHVSVSPNQQTGRSTSFKMRGDVAMSGV
FGYELDLADLTEEDRQMVKEQIKFYKAHRHLIQYGAFIRLESPFDSNTVAWEFVSPDKSE
ALLFMFKQLHTNRFEINNTKMAGLDPTIDYHDEMTDKTYGGDELMNVGLFRDPTHTGDFI
SEVHYFKGE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacagcaacgtgtttttcacttaaaaaataaagaaatttcctat
ttattttcagtagaagagggaaatatcctcagtcacctttattttggaccggcaattcgc
aactaccatggtgaacgtcgatatccacgagttgatcgtggattttcagggaaccttcct
gggtcgatggaccgaacttactctaaagatgatttgttgcaggagtattcaggaaacaat
accggagactatcgcgtgcctgcgattattatcaaaacagaaaatggttcacgactgact
gatttccgttacaagtcttataagattttaccggggaagcccaaactagctgggttacct
gcatcttatgttaaaagtgataaagaagcagaaacgttggaagttattttggttgatgaa
acaattggtgcgcaacttattctttcgtacactatctataacgaacggccggttattaca
aggaatgcgcggttagtaaacacaagcaatcaagaattacgaattgaaaagattgcctca
atgcaactagatttaactaaacatgattatgacgttatctccgttccaggccagtatgcc
cttgaacgacaacctgaacggcaagaattacgtcggggaataacagaattttctagccgt
cgaaattctagttctcatcatatgaacccgtttgtggccttggttgataagaataccgat
gaatttcaaggaaacgctttgggagtgctccttgtttactctggtaatcaccagtttacc
ttggaaaaagatcagattgaccagattcgcttaataaccggaattaatgattatgacttt
gaatgggttcttgaaccgggaaaagattttcagacaccggaagcaatcatgggctttagt
cagcagggcctaaatgggatgtcacaagtattccacaagttattacgggaccgggttgct
cgcggtaagtatcaatatgcagaccgcccaattgttattaataattgggaagcgaccttc
tttgactttgatgataagaagttagaccaaattattgatgaagcaaagccattgggaatt
gaaatgtttgttcttgatgacggctggtttggccaccggaatgatgataattcatcgctt
ggtgattggtttgttaaccaggataagcttactggtggattaaagcgggtagcagaccgg
acccacgagcatggcatgaaattcggcctctggtttgagccagaaatgatttcagtcgat
tctaagttatataaggaacatccagactatgccttacatgaaccgaaccgtggcatgaca
ctttctcgtaatcaattagtactagactttagccgtaaagaagtcgttgataatatttac
aatcaaatgtgcttaattttagataaggtgctgcttgactatattaaatgggacttcaac
cgtaatcttactgaagtcttctctagcgcagcggatgcagaccatcaaggagaaattagc
caccgttatgttttaggtttatatgacttaatggagcggttagttacccgttatcctaat
attttgtttgaaggctgctctggcggtggtggccgctttgatgctggtattctttactac
atgccgcaaagttggccatcagatgatacagacgcggtcgaacggttaaagatccaatac
ggaacatctttaacttatccaatctcatctatgacggcgcatgtatcagtttcacctaac
cagcaaactggtcgttctactagttttaagatgcggggcgatgttgccatgagcggggtc
tttggctatgaacttgacttagcagatttgactgaagaggatcggcaaatggtaaaggaa
cagatcaagttctacaaggctcaccgccacttaattcaatatggtgcctttattcgctta
gaaagtccttttgatagcaatacagtcgcttgggaatttgtcagtcctgataagtcagaa
gcgctgctatttatgtttaagcagttgcatactaaccgttttgaaattaataataccaag
atggcgggacttgatccaacaattgattatcatgatgagatgaccgataagacttatggt
ggggatgaattgatgaatgtcggtttgttccgtgacccgactcatacgggggacttcatt
tccgaagtgcattactttaaaggtgaatag

DBGET integrated database retrieval system