KEGG   Lactobacillus reuteri JCM 1112: LAR_1012Help
Entry
LAR_1012          CDS       T00735                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAR_1012
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LAR_1012
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAR_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1166338..1167840)
Genome map
AA seq 500 aa AA seqDB search
MSEQQYIMAIDQGTTSSRAIIFDHDGNKVAISQQEFPQYFPQPGWVEHDPLEIWDSVQSV
ISNVMIKSQIKPYKIAAIGITNQRETTVIWDRHTGKPIYNAIVWQSKQTSDIAEQLIKDG
YKDMIHQKTGLVIDSYFAATKIKWILDHVPGAREKAAKGDLMFGTIDTWLLWNLSGRRVH
ATDVTNASRTMLFNIHTLDWDQDILDLLDIPQSLLPVVKPSSAIYGYTGDYHFYGVQIPI
AGIAGDQQAALFGQAAYDKGSIKNTYGTGAFIVMNTGLKPTLSDNGLLTTIAYGLDGQTH
YALEGSIFVAGSAVQWLRDGLKMFDKASESEQMAVDAKTTGGVYVVPAFTGLGAPYWDQE
VRGAMFGLTRGTERGHIIRATLEAIAYQTKDVVDTMVKDTQLPLTALTVNGGASRNNFMM
QFQADILQTPIKRAAMEETTALGAAFLAGLAVDFWEDQDELRKLSRIGDQFDPQMDPQKA
ADLYRGWQRAIAAAQFYGKD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaacaacaatatatcatggcgattgaccagggaacgacgagctcacgggcgatt
atctttgaccatgacggaaataaggttgcgatcagtcagcaggaatttccccaatacttc
ccgcagccggggtgggttgaacatgatcctctagagatttgggatagcgttcaatcagtg
atttcaaatgtaatgattaagtcccagatcaagccctataagattgcggcaattgggatt
actaaccaacgggagacgacggttatttgggatcgccataccggtaagccgatttataac
gcaattgtctggcaatcgaagcaaacgagcgacatcgccgaacaattgattaaagatggt
tataaggatatgatccaccagaagactggcttggtgattgattcgtatttcgcggccact
aagatcaagtggatccttgaccatgttcctggtgcccgggaaaaagcagcaaagggagac
ttgatgtttgggactatcgatacttggttactatggaatttatcgggacggcgggtccac
gcaacggatgtgaccaatgccagccggacgatgctttttaatatccataccctcgactgg
gatcaagatatccttgacctgcttgatattccccagtcgcttttgccagtagtaaagcca
agttcagccatttacggttatactggcgactaccacttctatggggtgcagattccaatt
gccgggattgcaggtgaccaacaagcagccctctttggtcaagcagcctatgataaaggt
tcaatcaagaacacctatgggactggagccttcatcgtcatgaatacgggactaaaaccc
acgctttcggataacggcttgttgacgacgattgcgtatggcctggacgggcaaactcat
tacgcgcttgaaggaagtatctttgtggccggttctgccgttcaatggttgcgggatggt
ctcaagatgtttgataaggcaagcgagtccgaacaaatggctgtcgatgccaagacaact
ggcggcgtttatgtcgtccccgcctttacaggattaggcgcaccgtactgggatcaagaa
gtgcggggcgcaatgtttggccttacccgtggaactgaacggggacatatcatccgtgca
actttggaagccattgcctaccagaccaaagatgttgtcgatacgatggtcaaggacacc
caattaccactaacagcactaacggttaacgggggcgcttcacggaacaacttcatgatg
cagttccaggccgatatcttacaaacgccaatcaagcgggcagcaatggaagagacaacc
gcgctgggagcagcctttctcgctggattggccgttgatttctgggaagaccaggatgag
ttacggaagctatcacggattggcgaccagtttgatccacaaatggatccgcaaaaggca
gctgacttgtatcggggatggcaacgggccattgcagctgcgcagttttatggcaaagat
taa

DBGET integrated database retrieval system