KEGG   Lactobacillus reuteri JCM 1112: LAR_1032Help
Entry
LAR_1032          CDS       T00735                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAR_1032
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LAR_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1186660..1188678)
Genome map
AA seq 672 aa AA seqDB search
MMKKELPRFLYGGDYNPEQWPEETWDEDIKVFKQADINSATINVFSWALLEPQEGKYDFT
KLDKIIKELTVADFDIVLATSTAAMPAWMFKKYPDVARVDYQGRRHVFGARHNFCPSSKN
YRRLAKNLVEQLAKRYGDNPHIVAWHVNNEYGGNCYCEECQTEFQQWLKARYQTLDNLNH
AWNMNVWSHTIHDWNEIVVPNELGDAWGPEGSETIVAGLSIDYLRFQSAQMLDLFKMEKQ
IIEKYDPTTLVTTNFHSLPNKMIDYQQWASAQDIISYDSYPAYDAPIYQPAFLYDLMRSL
KHQPFMLMESTPSQVNWQPYSPLKRPGQMAATELQAVAHGADTVQFFQLKQALGGSEKFH
GAVISHANRTDTRVFKEVAKLGHDLRKVGPVIKDSQTKARVALIFDWSNFWSFEYVDGIT
QDLKYVPIILDYYRQFYELNIPTDVISVDDDFRQYDLVVAPVLYMVKGGLGKKITDYVAN
GGNFITSFMSGMVNESDNIYPGGYPGPLKDVMGLWVEESDAILPNKDVKLTMTTGDELTG
YLIADLIRLNGAHVLAEYASEFYAGTPAVTENTYSKGKAWYVGSRLDHASLRKIIMHIVD
DVHLSALVKEPTELEITKRQNSAGQDIYFVLNMGKGKQPLPVEFQKGYRDLLTGDSPETM
LDSWDVEILVQE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaagaattgccgcgtttcttatatggtggcgactataatccggaacagtgg
ccagaagaaacgtgggatgaagatattaaagtatttaaacaggcagatataaattccgcc
acgatcaatgttttttcatgggctttgcttgaaccgcaggagggaaaatacgattttact
aagcttgataagattatcaaagaattaacagttgctgattttgatattgtccttgcaact
tcaacagccgcgatgcccgcttggatgtttaagaaatacccagatgttgcgcgggtcgac
taccaaggacgccgccatgtatttggtgcccggcataacttttgcccaagcagtaaaaac
tatcggcgcttagcgaaaaatcttgttgaacagcttgctaaaaggtatggcgataatccg
catattgttgcttggcatgttaataatgaatatggtggcaattgttattgtgaagaatgc
caaacagaatttcagcaatggttaaaggcgcgctatcaaaccttggataatcttaatcat
gcatggaatatgaatgtgtggagtcatacaattcatgactggaatgagattgttgtgcct
aatgaacttggtgatgcatggggtccagaaggatcggaaacaattgtcgccggactttca
attgattatttacgttttcaatcggcccaaatgcttgatttatttaagatggaaaagcaa
atcattgaaaaatatgacccaacgactttagtcactactaactttcatagtctgcccaat
aaaatgattgattatcagcagtgggctagtgcgcaagacatcatatcatatgatagttat
ccggcttatgatgcgccgatttatcaaccagcattcttatatgatttgatgcgttcccta
aaacaccaaccgtttatgctgatggaatcgacgccatcacaagttaattggcaaccatat
agcccattaaagcgtccgggacagatggcagccactgaattacaggcagttgcacatggt
gcggatactgttcaatttttccagttgaagcaggcactgggcggatcagaaaagtttcat
ggtgccgtgattagtcacgccaaccggactgatacccgggtatttaaagaagtggcgaaa
ttaggtcatgatttaagaaaagtgggcccggttattaaagattctcagactaaagcgcgg
gtggcccttatctttgactggagtaatttctggtcttttgagtatgtcgatggtattacc
caggacctaaaatatgtaccaattattcttgattattatcggcaattttatgagctgaat
attccgactgatgtaatttccgttgacgatgattttagacagtatgatctcgtagttgct
cctgtcctttacatggttaagggtggcttaggcaagaagattacggattatgttgctaac
ggtggtaattttattactagttttatgtccggaatggtaaatgaatccgacaatatttat
cctggtggctaccctggaccattgaaagatgtaatgggactgtgggttgaagaaagtgat
gcaatcctccctaataaagatgtcaaattaacaatgacgaccggggatgaattaactgga
tatttgatagcggatttaattcgccttaatggagctcatgtcctggctgaatacgctagt
gaattttatgctgggactcccgcggtaaccgagaatacctattcaaaagggaaagcatgg
tatgttggtagtcgccttgaccatgctagtctccgtaagatcataatgcatattgttgat
gatgtgcacctttccgcgttagttaaagaaccaacagaactggagataacaaaacgccaa
aattcagcaggtcaggatatttactttgtccttaatatgggaaagggtaaacaaccatta
ccagtagaatttcaaaagggttatcgagaccttttgactggcgattcacctgaaacgatg
cttgattcgtgggatgttgagatcttggttcaagaataa

DBGET integrated database retrieval system