KEGG   Lactobacillus reuteri JCM 1112: LAR_1139Help
Entry
LAR_1139          CDS       T00735                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00010  Glycolysis / Gluconeogenesis
lrf00052  Galactose metabolism
lrf00500  Starch and sucrose metabolism
lrf00520  Amino sugar and nucleotide sugar metabolism
lrf00521  Streptomycin biosynthesis
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
lrf01200  Carbon metabolism
Module
lrf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_1139
   00052 Galactose metabolism
    LAR_1139
   00500 Starch and sucrose metabolism
    LAR_1139
   00520 Amino sugar and nucleotide sugar metabolism
    LAR_1139
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LAR_1139
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LAR_1139
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LAR_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAG25655
Position
complement(1295664..1296635)
Genome map
AA seq 323 aa AA seqDB search
MAKKLIGVDLGGTTIKFAILTENGEIQQKWSLRTNILDDGSHIVPDIINSINHHLDLYKM
SRDQFIGIGMGTPGTIDREKGTVIGAYNLNWKTTQNVKEDIEQGTGMQFALDNDANVAAL
GERWKGAGNEGDDVAFITLGTGVGGGLISNGKLIHGVVGAGGEVGHMIVKPDGYLCTCGN
HGCLEQYASATGIVHIAQDKAEEYEGNSRLKAMIDNGDEITAKIVFDLAKENDYLANTVV
DEVCFYLGLATANLSNALNPEYLVIGGGVSAAGEFLLKRVKQNFEKFAFPTVRTSTQLKL
AELGNDAGVIGAASLARQFVNAD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaattaattggtgttgaccttggtggtactactatcaagtttgcaatttta
acggagaacggtgagattcaacaaaagtggtctttacggactaacattttggatgatggt
tcacacattgtgccagacatcattaactcaattaatcaccaccttgatttatacaaaatg
tctcgagaccaatttattggaatcggaatgggaactcccggaacaattgaccgtgaaaag
ggaactgttattggtgcctacaacttaaactggaagacaacgcaaaatgttaaagaagac
attgaacaaggcactgggatgcaatttgctctggataacgatgctaacgttgccgcactt
ggtgaacgttggaagggtgctggtaatgaaggtgacgatgttgcatttattactttaggt
accggtgttggtggtggacttatctccaatggtaagcttatccacggtgtcgttggtgct
ggtggtgaagttggtcacatgattgttaagccagatggatacctttgtacttgtggaaac
catggatgtcttgaacaatatgcatctgccactggaattgttcatatcgctcaagataaa
gcggaagaatatgaaggtaacagtcgtttgaaggcaatgattgataacggtgacgaaatt
acagccaagattgtttttgaccttgctaaggaaaacgactaccttgctaatactgttgtt
gatgaagtttgcttctacctcggtttagcaactgccaacttaagtaacgcattgaaccct
gaataccttgttatcggtggtggagtttccgcagctggtgaattccttttgaagcgggta
aagcaaaactttgaaaaatttgccttcccaacagttcggacttcaactcaattgaagtta
gctgaattaggtaatgatgctggtgttatcggtgctgcttcattagctcgtcagtttgta
aacgcagattaa

DBGET integrated database retrieval system