KEGG   Lactobacillus reuteri JCM 1112: LAR_1139Help
Entry
LAR_1139          CDS       T00735                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAR_1139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_1139
   00052 Galactose metabolism
    LAR_1139
   00500 Starch and sucrose metabolism
    LAR_1139
   00520 Amino sugar and nucleotide sugar metabolism
    LAR_1139
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LAR_1139
   00524 Butirosin and neomycin biosynthesis
    LAR_1139
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LAR_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295664..1296635)
Genome map
AA seq 323 aa AA seqDB search
MAKKLIGVDLGGTTIKFAILTENGEIQQKWSLRTNILDDGSHIVPDIINSINHHLDLYKM
SRDQFIGIGMGTPGTIDREKGTVIGAYNLNWKTTQNVKEDIEQGTGMQFALDNDANVAAL
GERWKGAGNEGDDVAFITLGTGVGGGLISNGKLIHGVVGAGGEVGHMIVKPDGYLCTCGN
HGCLEQYASATGIVHIAQDKAEEYEGNSRLKAMIDNGDEITAKIVFDLAKENDYLANTVV
DEVCFYLGLATANLSNALNPEYLVIGGGVSAAGEFLLKRVKQNFEKFAFPTVRTSTQLKL
AELGNDAGVIGAASLARQFVNAD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaattaattggtgttgaccttggtggtactactatcaagtttgcaatttta
acggagaacggtgagattcaacaaaagtggtctttacggactaacattttggatgatggt
tcacacattgtgccagacatcattaactcaattaatcaccaccttgatttatacaaaatg
tctcgagaccaatttattggaatcggaatgggaactcccggaacaattgaccgtgaaaag
ggaactgttattggtgcctacaacttaaactggaagacaacgcaaaatgttaaagaagac
attgaacaaggcactgggatgcaatttgctctggataacgatgctaacgttgccgcactt
ggtgaacgttggaagggtgctggtaatgaaggtgacgatgttgcatttattactttaggt
accggtgttggtggtggacttatctccaatggtaagcttatccacggtgtcgttggtgct
ggtggtgaagttggtcacatgattgttaagccagatggatacctttgtacttgtggaaac
catggatgtcttgaacaatatgcatctgccactggaattgttcatatcgctcaagataaa
gcggaagaatatgaaggtaacagtcgtttgaaggcaatgattgataacggtgacgaaatt
acagccaagattgtttttgaccttgctaaggaaaacgactaccttgctaatactgttgtt
gatgaagtttgcttctacctcggtttagcaactgccaacttaagtaacgcattgaaccct
gaataccttgttatcggtggtggagtttccgcagctggtgaattccttttgaagcgggta
aagcaaaactttgaaaaatttgccttcccaacagttcggacttcaactcaattgaagtta
gctgaattaggtaatgatgctggtgttatcggtgctgcttcattagctcgtcagtttgta
aacgcagattaa

DBGET integrated database retrieval system