KEGG   Lactobacillus reuteri JCM 1112: LAR_1188Help
Entry
LAR_1188          CDS       T00735                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LAR_1188
   00330 Arginine and proline metabolism
    LAR_1188
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LAR_1188
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LAR_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1338851..1339771
Genome map
AA seq 306 aa AA seqDB search
MNLNDAIQECWSKIDEGQVATYIPALAKVDPYQLGVYLFDVTNDKKAEAGASQVRFAIES
VSKVITLLYAIERLGLSAVEEQVGTRQTGFPFDTILNMEITKETHPLNAFINSGAILISS
LIEEQDGLSPFDQILEFSRKICNDPAITLNEEIYQSELRTGDMNRSLAYYLKAKEVLTND
VTLSLDTYFKQCSMMVTCQSLANLGAVLANDGIAPWNNERIISSEAATYTKSVMMTTGLY
NESGTYSVRIGVPTKSGVGGGLVSASPNHYGIGIFSPALDHAGNSVAGLALLELISKKLK
LDVFRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaatgacgcaattcaagaatgttggagcaaaattgatgaaggacaggtagca
acctacattcccgctttagcaaaagttgacccttatcaacttggcgtttacctttttgac
gtcacaaatgataaaaaagcagaagcaggcgcatcgcaagttcgatttgccatcgaaagc
gtctcgaaagtaatcaccctcctctacgcaattgaacgtttaggcttgtcagcagttgaa
gaacaagtcggaacacgccaaactggcttccccttcgatacaatccttaacatggaaatt
accaaagagacccatcctctcaacgcttttattaacagtggcgccatcctcattagttca
ttaatcgaagaacaagatgggctttctccctttgaccaaatccttgaatttagtcgtaaa
atctgcaatgatcccgctatcaccctcaatgaagaaatttaccaatcggagttgcgaacc
ggggatatgaatcggtcgttagcctactatctcaaggccaaagaagtcctcactaatgat
gtaacccttagccttgatacctattttaagcagtgttcaatgatggtcacttgccaaagt
ctagctaatctcggtgctgtccttgccaatgacgggatcgctccttggaataatgaacga
atcatttcaagcgaggctgctacatatacaaaatcggtcatgatgacgactggcctctac
aatgaatcaggaacctattccgttcgaatcggcgtaccgactaagagcggtgtcggtggc
ggtttagtttctgcttcccccaatcattacgggatcggaattttcagtccggcactcgac
catgctggtaatagtgttgccgggctagcactccttgaactcatcagcaaaaaattaaag
cttgatgtttttaggtactag

  All links  
No link information was found.   
DBGET integrated database retrieval system