KEGG   Lactobacillus reuteri JCM 1112: LAR_1212Help
Entry
LAR_1212          CDS       T00735                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LAR_1212
Enzymes [BR:lrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LAR_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1367711..1368223)
Genome map
AA seq 170 aa AA seqDB search
MTEAYLSIGSNMGDRLANLQKAIQLLNVPPKIDIMAISSVYETEPVGDVKQDSFYNIAVK
VATKLTAQQLLDHLHNIEQELHRRRLIHWGPRTIDLDIIDFGHQHIKTPTLTIPHPEMAN
RQFVLLPMREITNQNDPYYQQLDHLLNKTPDHNWLKKIYGREVFSWTNKK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctacctaagtattggcagtaatatgggcgaccggttagcgaaccttcaa
aaagcgattcagctgttgaatgtgccacctaaaattgatattatggcgatttcctcagtt
tatgaaacagaaccggtgggggatgtcaaacaagattctttttacaatattgcagttaag
gttgcgactaagttaacagctcagcaactcctcgaccaccttcacaatatcgaacaagag
ttacatcgacgccggcttattcattggggaccacggacaattgaccttgatattattgat
tttggtcatcaacatatcaaaacaccaacgctaacgatccctcatccagaaatggctaac
cggcagtttgttttattaccaatgcgcgaaattactaatcaaaatgatccttattatcaa
caattggatcatttgttaaataagactccagaccataattggcttaaaaagatatatgga
cgagaggtgttttcatggaccaacaaaaaatag

DBGET integrated database retrieval system