KEGG   Lactobacillus reuteri JCM 1112: LAR_1224Help
Entry
LAR_1224          CDS       T00735                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lrf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lrf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376175..1377578)
Genome map
AA seq 467 aa AA seqDB search
MTDWMKAAEAQKENYLNDLVALMKIPSVRDDSAATDEYPLGPRPAQALKAFLEMAEQDGF
KVKNIDNLVGYAEWGEGDETLAILAHLDVMPAGKGWDTDPFDPVIKDGNLYGRGASDDKG
PGMAAYYALKYLKDQGVKFNKKVRFIVGTDEESNWTGMHRYFEVEPAPTFGFSPDAEFPV
INGEKGQVSLLLDVPAGNGDASTQLVSFESGLRFNMVPREAVALMRTDNPQEVTNDFGHF
IEENPVEGNIESTDKGLKITVIGKAAHGMEPEKGINAATYLAKFLNRYDFGGGAKSFIEF
LADYLHLDTRMDGFNGAYTDPVMGELTMNAGILNFDADKGGHIDMNFRFPKGVTPDKLED
TVKAIADKLQIKVTQGPSQAPHYVDPDDPIVKTLMQAYIDQTGDTDAKPEVVGGGTYGRL
MKRGVAFGALMPHTPNTMHQANEYQPVKDLITSMAIYMEAINNLVTD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgactgattggatgaaagccgcagaggcgcaaaaagaaaattatttaaatgatctcgta
gcattaatgaagatccccagtgtccgtgatgattcggcggcaacagatgaatacccgctt
ggccctcgtcctgcgcaagcgctaaaagcatttttagagatggcagaacaagacggtttt
aaagtaaagaacatcgataaccttgttgggtatgctgaatggggtgaaggcgatgaaaca
cttgctattttagcccatcttgacgtaatgcctgctggtaagggttgggatacggatcca
tttgacccagttatcaaggatggcaacttatatggtcgtggtgcttctgatgataaggga
cctggaatggccgcttactatgccttgaagtatttgaaagatcaaggcgtaaagtttaac
aagaaagttcgttttatcgttggaactgatgaagaaagtaactggactggaatgcaccgt
tactttgaagttgagccagccccaacatttggtttttcaccagatgcggaattcccagta
attaacggtgaaaagggtcaagtatcgctcttgcttgatgtccctgctggcaatggggat
gcctcaacacaactagttagttttgaatctggcttacgtttcaacatggtaccgcgggaa
gcagttgccctcatgcggacggataaccctcaagaagttactaatgattttggccacttt
attgaagaaaacccggttgaaggtaatattgaatcaacagataaggggcttaagattact
gtcatcggaaaagctgcgcatggaatggaaccagaaaagggaatcaatgcagcaacctac
cttgcaaagttcttaaatcgatatgactttggtggaggcgcaaagagcttcattgaattc
ttagctgattatcttcatttagatacgcggatggatggctttaatggtgcttacactgat
ccggtaatgggtgaattaactatgaacgccggaattttaaactttgatgcggacaagggt
ggccacattgacatgaacttccgcttccctaaaggtgtgacaccagataagctagaggat
actgtaaaggcgattgccgacaaattacaaattaaagttacacaaggtccatctcaagct
ccacattatgttgatccagatgatccaatcgttaagacattgatgcaagcttatattgac
caaactggagatacagacgcaaaaccagaagtcgttggtggtggaacttatggtcgtttg
atgaagcggggcgttgcctttggtgctttaatgccacatacgccaaatacaatgcatcag
gctaatgaatatcaacctgttaaagatttaattacatcgatggcgatttacatggaggca
attaataatctcgttactgattaa

DBGET integrated database retrieval system