KEGG   Lactobacillus reuteri JCM 1112: LAR_1406Help
Entry
LAR_1406          CDS       T00735                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LAR_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_1406
  Lipid metabolism
   00071 Fatty acid degradation
    LAR_1406
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAR_1406
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAR_1406
   00626 Naphthalene degradation
    LAR_1406
Enzymes [BR:lrf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAR_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1588256..1589284)
Genome map
AA seq 342 aa AA seqDB search
MKAAVINDPVDGFVTVKDVQLRDLKPGEALVDMEYCGLCHTDLHVAAGDFGKKPGRIIGH
EGVGRVSKVAPGVTSLKVGDRVSIAWFFKGCGHCEYCLTGRETLCRNVLNAGYTADGAMA
EQCIVPADYAVKVPEGLDPVEATSLTCAGVTMYKALKVADIKPGQWVSIVGAGGLGNLGI
QLAHNVFGAHVIAVDGNPDKLEAAKKNGAEILINRHDGDVDKQIQEKVGGVHAAVVTAVS
ASAFDQAVDSLRPDGKLVAVALPQGDMKLNIAKTVLDGIIVAGSLVGTRQDLAECFQFGA
EGKVHPIVKTRKLSEINDMIQELKDNKVVGRNVVDFVHNDND
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttattaatgatccagtagacggttttgttactgttaaagatgttcaa
cttcgggatttgaagcccggtgaagctttagttgacatggaatattgtggtctttgtcac
actgatctacacgttgctgctggggactttggtaagaagcccggtcgtattatcggtcac
gaaggggttggtcgtgtatctaaggttgcccctggcgttacttccttgaaagttggcgac
cgtgtatcaattgcatggttcttcaagggctgtggacactgtgaatattgtttaactggt
cgtgaaactctttgtcggaacgttcttaatgcgggttacactgctgacggtgcaatggct
gaacaatgtatcgtaccagctgactacgctgttaaggttccagaaggtcttgatcctgtt
gaagctacttcattaacttgtgctggtgttacgatgtacaaggcattaaaggttgctgac
atcaagccaggtcaatgggtatcaatcgttggtgctggtggtttaggtaacttgggtatt
caacttgctcacaacgtatttggtgctcatgttatcgctgttgatggtaatcctgataag
cttgaagccgctaagaagaatggtgctgaaattttaattaaccgtcatgacggtgatgtt
gataagcaaattcaagaaaaggttggcggtgttcacgctgctgtagtaacagctgtttct
gcctctgcattcgaccaagcagttgattcacttcgcccagatggtaagcttgttgccgtt
gcgcttccacaaggtgacatgaagcttaacattgctaagactgttcttgatggtatcatt
gttgctggttcattagttggtacccgtcaagacttagctgaatgtttccaatttggtgca
gaaggtaaggttcacccaattgttaagactcgtaagttaagcgaaattaatgatatgatc
caagaacttaaggataacaaggttgttggtcggaatgttgttgattttgttcacaacgat
aacgactaa

DBGET integrated database retrieval system