KEGG   Lactobacillus reuteri JCM 1112: LAR_1452Help
Entry
LAR_1452          CDS       T00735                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LAR_1452
Enzymes [BR:lrf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LAR_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1638693..1640150)
Genome map
AA seq 485 aa AA seqDB search
MPIKNEAMLITYSDSMGKNIKETHEVLKNYIGDAIGGVHLLPFFPSTGDRGFAPYRYDVV
DSAFGNWDDVEALGEDYYLMFDFMINHISKKSEMYQDFKKKHDDSKYNDFFIRWEKFWEK
AGKNRPTQEDVDLIYKRKDKAPKQEITFDDGTTENLWNTFGEEQIDINVKSKVANEFFKE
TLIDMVKHGADMIRLDAFAYAIKKVGTNDFFVEPEIWDLLNEVQDILAPYKAIILPEIHE
HYTIPQKISQHDFFIYDFTLPMTTLYTLYSGKTNRLAKWLKMSPMKQFTTLDTHDGIGVV
DAKDILTDDEIEYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKAYLLS
RAFQVFAPGIPMVYYVGLLAGSNDLELLEKTKEGRNINRHYYTKEEVAQEVQRPVVKNLL
DLLAWRNKFAAFDLDGSIEVETPTETTIKVTRKDKDGKNVAVLDADAANKTFTITANGEK
VMEQK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaaaatgaagcaatgttaattacttactctgactcaatgggtaaaaatatt
aaagaaactcatgaagtattaaagaactatatcggtgatgcaatcggcggtgttcactta
cttccattcttcccatcaactggtgaccgtggttttgcaccataccgttacgatgttgtt
gattctgcttttggtaactgggatgatgttgaagcattaggtgaagactactacttaatg
tttgacttcatgattaaccatatttccaagaagtctgaaatgtaccaagacttcaagaag
aagcacgatgattctaagtacaacgacttctttattcgttgggaaaagttctgggaaaaa
gctggtaagaaccgtccaactcaagaagatgttgatttaatttacaagcgaaaggataag
gctcctaagcaagaaattacctttgatgatggtactactgaaaacttatggaacactttc
ggtgaagaacaaattgatattaatgttaagagtaaggtagctaacgaattcttcaaggaa
acattaattgacatggttaagcacggtgcagatatgattcgtcttgatgcctttgcttac
gctattaagaaggttggtactaatgatttcttcgttgaacctgaaatctgggatctttta
aatgaagttcaagatattttggctccttacaaggccatcatccttcctgaaattcacgaa
cactacaccattccacaaaagatttcacaacatgacttcttcatctatgactttacctta
ccaatgactactctttataccctttactctggtaagactaaccgccttgctaagtggtta
aagatgtcaccgatgaagcaatttactactcttgatactcatgatggtattggggttgtt
gatgctaaggatatcttaactgatgatgaaatcgaatatgcatccaatgaattatacaag
gttggtgctaacgttaagcggaaatactcaagtgctgaatacaacaacttggatatttac
caaattaactctacttactactctgcattaggtgacgatgacaaagcttacttgctttct
cgggcattccaagtatttgcacctggtattccaatggtttactatgttggtttacttgct
ggttcaaatgaccttgaattacttgaaaagactaaggaaggtcggaacatcaaccgtcac
tactacactaaagaagaagttgcacaagaagttcaacgtccagtagttaagaatctctta
gacttacttgcatggcggaataaatttgcagcctttgatcttgatggttcaattgaagtg
gaaacaccaactgaaacaactatcaaggttacgcggaaagataaggatggcaagaatgtg
gctgttcttgatgctgatgctgctaacaagactttcactattacagctaatggtgaaaaa
gtgatggaacaaaaatag

DBGET integrated database retrieval system