KEGG   Lactobacillus reuteri JCM 1112: LAR_1574Help
Entry
LAR_1574          CDS       T00735                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAR_1574
Enzymes [BR:lrf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LAR_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1785439..1787850)
Genome map
AA seq 803 aa AA seqDB search
MAVDYDSKKYLESVDAYWRAANYLSVGTLYLMGDPLLRQPLKAEDVKPKPIGHWGTIVPQ
NFIYAHLNRVIKKYDLDMFYIEGSGHGGQVMVNNSYLDGSYTEIYPEYTQDTKGMAKLFK
HFSFPGGTASHAAPETPGSIHEGGELGYSLSHGVGAILDNPEVIAAVEIGDGEAETGPLM
ASWFSDKFINPIKDGAVLPIIQVNGFKISNPTILSWMSDEELTKYFEGMGWKPYFVSAYK
EADRDGEFKGYKPHMEVHEEMAKTLDKVVEEIKAIQKNARENNDNSLPQWPMIIFRAPKG
WTGPKTDLDGNPIENSFRAHQIPVPVSQDDMEHKDILVDWLKSYKPEELFDEDGHPVALV
EENTPEGNRRMAMNPITNGGIDPKPLVLPNYRDFAIDVQNPGSVVKQDMLEWGKYLNKMA
ELNPTNFRGFGPDESKSNRLYAFLDGQKRQWMESVHEPNDEDVAPQGRMIDSQLSEHQAE
GFLEGYTLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKDLYWRHQYPALNFVDTSTVF
QQDHNGYTHQDPGLLTHLFEKERPDLVKEYLPADTNSLMAVSNKAFRNQECINLFVTSKH
PRAQWFSIDEATQLADNGLGYIDWASTDQGTEPDVVFASSGTEPTEEALAAIDILHDNFP
ELKIRYINIIEIMRLMNTDKNPEGLTDAEFNSYFTTDKPVIFAWHGFRDMIQALFFDRAN
RNVHIHSYEENGDITTPFDMRVLNELDRFHLAKDAIQSVPGYEQKSAAFVAKMDNMINKH
NHYIRSEGKDLPEVTNWTWKGLK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagattacgattccaagaaatacttggaaagtgttgatgcttactggcgtgca
gctaactacctttcagttggtacattgtacttaatgggtgatccattacttcgccaacca
ttaaaggcagaagatgttaagcctaagccaattggtcactggggtactattgttcctcaa
aacttcatttacgcacacttgaaccgtgtaattaagaagtatgaccttgatatgttctac
atcgaaggttcaggtcacggtggccaagttatggttaacaactcatacttggatggttca
tacactgaaatttatcctgaatatactcaagacactaagggaatggctaagttattcaag
cacttctcattcccaggcggtactgcatcacacgctgcacctgaaacaccaggttcaatc
cacgaaggtggggaacttggttactcactttcacacggtgttggtgctatcttagataac
ccagaagttattgccgctgttgaaatcggtgatggtgaagctgaaactggtccattaatg
gcatcatggttctcagacaagttcattaacccaatcaaggatggtgcggtattaccaatc
atccaagttaacggattcaagatttctaaccctactatcctttcatggatgagcgacgaa
gaacttactaagtacttcgaaggtatgggttggaagccatactttgtttcagcttacaaa
gaagctgaccgtgatggtgaattcaagggttacaagcctcacatggaagttcacgaagaa
atggctaagactttggacaaggttgttgaagaaatcaaggctattcaaaagaacgctcgt
gaaaacaatgataactcattaccacaatggccaatgattatcttccgtgcacctaagggt
tggactggtcctaagactgaccttgatggtaacccaattgaaaactcattccgtgcacac
caaattccagttccagtatcccaagatgacatggaacacaaggacatccttgttgattgg
ttgaagtcatacaagccagaagaattgtttgacgaagatggtcacccagttgctcttgtt
gaagagaacacaccagaaggtaaccgtcgtatggctatgaaccctatcactaatggtggt
atcgatcctaagccacttgtattgccaaactaccgtgattttgctattgatgttcaaaat
cctggttctgttgtaaagcaagacatgcttgaatggggtaagtacctcaacaagatggct
gaattgaacccaactaacttccgtggatttggtcctgacgaatctaagtcaaaccgtctt
tacgcattccttgatggtcaaaagcgtcaatggatggaaagtgtccacgaaccaaacgac
gaagatgtggctccacaaggtcgtatgatcgattcacaactttcagaacaccaagctgaa
ggattccttgaaggttacacattaactggtcgtcacggattcttcgcaacttacgaagca
ttcggtcgtgttgttgattcaatgcttactcaacacatgaagtggttacgtaaggctaag
gatctttactggcgtcaccaatacccagcattgaactttgttgatacttctactgtattc
caacaagatcacaacggttacactcaccaagatccaggtctattgactcacttgtttgaa
aaggaacgtccagacctcgttaaggaatacttgccagcagatactaactcattaatggct
gtatctaacaaggcattccgtaaccaagaatgcatcaacctcttcgtaacttctaagcac
ccacgtgcacaatggttctctattgatgaagctactcaattggctgacaatggtcttggc
tacattgactgggcatctactgaccaaggtactgaaccagatgttgtatttgcatcttct
ggtactgaacctactgaagaagctcttgcagctattgacattcttcatgacaacttccct
gaattgaagattcgttacatcaacatcatcgaaattatgcgtttgatgaacactgacaag
aaccctgaaggtttaactgatgctgaattcaatagttacttcactactgacaagccagtt
atctttgcatggcacggattccgtgacatgatccaagcattgttcttcgatcgtgctaac
cgtaacgttcacattcactcatacgaagaaaatggtgatatcaccactccattcgacatg
cgtgtattaaacgaacttgaccggttccacttagctaaggacgctatccaaagtgttcct
ggttacgaacaaaagagtgctgcatttgttgccaagatggacaacatgatcaacaagcac
aaccactacatccgttcagaaggtaaggacttaccagaagttactaactggacttggaag
ggtcttaagtaa

DBGET integrated database retrieval system