KEGG   Lactobacillus reuteri JCM 1112: LAR_1589Help
Entry
LAR_1589          CDS       T00735                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lrf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802196..1803167)
Genome map
AA seq 323 aa AA seqDB search
MLQFDRHRRLRTSTAMRDLVRETHLNKDDLIMPVFVDATINGREEIPSMPGIYRYSLDSI
LDEITEIVKLGIKSIIIFGVPERKDEVGTGAWEDNGIVQQAIRLIKKNYPDLIVIADTCL
CEYTSTGHCGILKDGVVLNDESLKYLTKTAVSQVKAGADIIAPSNAMDGYVAAIRQGLDE
AGYKNTPIMSYAVKFASSFYGPFRDAADGSPKEGPKDRKTYQMDPANRLEALREVASDEK
EGADFVMVKPAMAFLDIMREVRNHTLLPLVAYNVSGEYAMIKAAAANGWINENQIVYESL
VGMKRAGADLIITYFAKDVAKKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaatttgatcgtcatcgtcgtttacgtactagcactgccatgcgtgatttagta
agagagactcatctcaataaggatgatctaattatgccggtctttgtggatgccactatt
aatgggcgagaagaaattccatcaatgccaggcatttaccgttacagtttagattcaatt
cttgatgaaattacagaaattgtgaagttaggaattaaatcaattattattttcggtgtt
ccagaaagaaaagatgaagttggaactggcgcatgggaagataatggaattgttcaacag
gcaattcgtttgattaagaaaaattatccagatttaattgttatcgctgatacttgttta
tgtgaatatacaagtactggtcactgtggaattcttaaagatggggtcgttttgaatgat
gaatcattaaaatacttaacaaagacagctgtaagtcaagtaaaagctggagctgacata
attgcaccgtctaatgcgatggatgggtatgttgcagcaattcgccaaggacttgatgaa
gcagggtataaaaatacaccgattatgtcctatgctgtgaaatttgcctcatcattttac
ggcccattccgtgatgctgctgatggttcgcctaaagaagggcctaaagatcgtaaaaca
tatcaaatggatccagctaatcgcttagaagcattgcgcgaagtagctagtgatgaaaag
gaaggtgctgattttgtgatggttaaaccagcaatggccttcttggatattatgcgtgaa
gttcgtaatcatactttgctgccgttagttgcatataatgtttctggtgaatatgcaatg
attaaagcagctgcggctaatggttggattaatgaaaaccaaattgtttacgaaagtctg
gttggaatgaaacgagctggagcagacttaattattacttactttgccaaggacgttgct
aagaaactttaa

DBGET integrated database retrieval system