KEGG   Lactobacillus reuteri JCM 1112: LAR_1589Help
Entry
LAR_1589          CDS       T00735                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LAR_1589
Enzymes [BR:lrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LAR_1589
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAR_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802196..1803167)
Genome map
AA seq 323 aa AA seqDB search
MLQFDRHRRLRTSTAMRDLVRETHLNKDDLIMPVFVDATINGREEIPSMPGIYRYSLDSI
LDEITEIVKLGIKSIIIFGVPERKDEVGTGAWEDNGIVQQAIRLIKKNYPDLIVIADTCL
CEYTSTGHCGILKDGVVLNDESLKYLTKTAVSQVKAGADIIAPSNAMDGYVAAIRQGLDE
AGYKNTPIMSYAVKFASSFYGPFRDAADGSPKEGPKDRKTYQMDPANRLEALREVASDEK
EGADFVMVKPAMAFLDIMREVRNHTLLPLVAYNVSGEYAMIKAAAANGWINENQIVYESL
VGMKRAGADLIITYFAKDVAKKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaatttgatcgtcatcgtcgtttacgtactagcactgccatgcgtgatttagta
agagagactcatctcaataaggatgatctaattatgccggtctttgtggatgccactatt
aatgggcgagaagaaattccatcaatgccaggcatttaccgttacagtttagattcaatt
cttgatgaaattacagaaattgtgaagttaggaattaaatcaattattattttcggtgtt
ccagaaagaaaagatgaagttggaactggcgcatgggaagataatggaattgttcaacag
gcaattcgtttgattaagaaaaattatccagatttaattgttatcgctgatacttgttta
tgtgaatatacaagtactggtcactgtggaattcttaaagatggggtcgttttgaatgat
gaatcattaaaatacttaacaaagacagctgtaagtcaagtaaaagctggagctgacata
attgcaccgtctaatgcgatggatgggtatgttgcagcaattcgccaaggacttgatgaa
gcagggtataaaaatacaccgattatgtcctatgctgtgaaatttgcctcatcattttac
ggcccattccgtgatgctgctgatggttcgcctaaagaagggcctaaagatcgtaaaaca
tatcaaatggatccagctaatcgcttagaagcattgcgcgaagtagctagtgatgaaaag
gaaggtgctgattttgtgatggttaaaccagcaatggccttcttggatattatgcgtgaa
gttcgtaatcatactttgctgccgttagttgcatataatgtttctggtgaatatgcaatg
attaaagcagctgcggctaatggttggattaatgaaaaccaaattgtttacgaaagtctg
gttggaatgaaacgagctggagcagacttaattattacttactttgccaaggacgttgct
aagaaactttaa

DBGET integrated database retrieval system