KEGG   Lactobacillus reuteri JCM 1112: LAR_1600Help
Entry
LAR_1600          CDS       T00735                                 

Definition
uroporphyrinogen-III C-methyltransferase CobA
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LAR_1600
Enzymes [BR:lrf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LAR_1600
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LAR_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1811438..1812832)
Genome map
AA seq 464 aa AA seqDB search
MNGRVTLLGAGPGNPELLTLIGKRRLNEADIVLYDRLIDPSLLAFTNNEAELIDVGKLPL
HHKVKQSKINEMLVDYAKQGKKVVRLKAGDPYVFGRGGEEAQVLQQFGVNFEVIPGITSA
IAGLAAAGIPITHRDYASSFHIITGHHKKNGQQLDWENIAHQEGTIVFLMGMAQLPKICQ
QLVEHGKSSQTPVAIIQWATQWRQKMVIGDLENINELVARHQLSSPALIVVGQVVKLSKQ
LNINKPLTGVHLLIPFSEHQRLFNSLEDLGATADFYQRALIEPLEVTLPSIDEYDAIIVD
DVLAYHQFITLLIKNGIDVRQLIDKKIIASNHRVVQALQKTGILAIKGMPQDIPVKRTIE
IGGSKPTYNIGTFLSLYEKKKRSLVLPFDLKEFSAVIFPSTASINDFLASLSEKQLSQVS
MLKAFAMGKKVQQAAIQAGFGHVVICPPDVKKTVIQVKEEFMHD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtagagtaacacttctaggtgccggaccgggtaatccagaattattaacgtta
attggcaagcggcgattaaatgaagcggatatcgtcttgtatgatcggttaattgatcct
tcgttattagcatttacaaataatgaggcggaattgatcgatgttgggaaattacctcta
catcataaggttaagcagtcgaaaatcaatgaaatgttagttgattacgctaagcaaggg
aaaaaggtcgttcgactaaaagctggtgatccttatgtctttggccggggtggtgaagag
gcacaggtattacaacagtttggtgttaattttgaagttattccagggattactagtgca
attgctgggctagctgcagcggggattcccataactcaccgtgactatgcttcaagcttt
catattatcactggtcatcataaaaagaatggtcagcaactggactgggaaaatattgct
catcaagaagggacaatcgtttttttgatgggaatggcgcaacttcctaaaatttgtcaa
cagctagtcgagcatggaaaatcatcgcaaacacctgtagcaataatacagtgggctacc
caatggcgacaaaagatggttattggcgatttggaaaatatcaatgaattggttgctcga
catcaactttcatcgccagcattaattgttgtaggtcaagtcgttaaattgagtaagcaa
ttaaatatcaataaaccattgaccggtgtgcatttattaattccttttagtgaacatcaa
cgcctttttaattcattagaagatttaggggcaactgctgacttttaccagcgtgcttta
atcgagccattagaagtgactcttccttctatcgatgaatacgatgcgattattgtggat
gatgtccttgcttatcatcaatttattaccctcttaataaagaatggtattgatgttcga
caacttatagataaaaaaattattgccagtaaccatcgagtagttcaagcattacagaaa
acaggaatcttagcaataaaaggcatgccgcaagatataccagtgaaaagaaccattgaa
attggtggcagtaaaccaacatataatattggaacttttcttagcttatatgaaaagaag
aaacggtcgcttgtattaccgtttgaccttaaagaattcagtgctgtcatttttccaagt
actgctagtataaatgattttttagcttcattaagcgaaaaacagctatcacaagtatca
atgttaaaagcatttgcaatggggaaaaaagttcaacaagctgcaattcaagctggcttt
ggtcatgtggttatatgtccaccagacgtaaagaagactgttattcaggtcaaggaggaa
tttatgcatgactaa

DBGET integrated database retrieval system