KEGG   Lactobacillus rhamnosus GG: LRHM_0098Help
Entry
LRHM_0098         CDS       T02100                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRHM_0098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHM_0098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LRHM_0098
Enzymes [BR:lrg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LRHM_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(103102..103911)
Genome map
AA seq 269 aa AA seqDB search
MSNLAAIFKNHKAFIPFVVADDPDFDTTVKNIVALAHGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFEIVAAARKETAVPIVFLTYLNIVFKYGYDAFLKRCAELKVSGL
VIPDLPYESRAEIVPFAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSVGITGERD
EFFTGLKTLVTEIKRYTDVPTAIGFGIHTPQQAQTMASIADGVIIGSAIVDIVAKEAQNA
PAAIEQFTKAIRAAVDTQKQTESVVSRNA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttagctgccatcttcaaaaatcataaagctttcatcccatttgtcgttgcg
gacgatccggacttcgataccactgtcaaaaacattgttgcccttgcacatggcggcgcg
gatattgtcgaattgggcattcccttttctgacccggttgcggatggaccagtgattcag
gctgcggacctgcgcgcatttgctgccaacgtgcgcaccaaaaccgtttttgaaatcgtt
gcggcagcgcggaaggaaaccgcggtgccgatcgtgtttctgacttacttaaacatcgtc
ttcaagtacggctacgatgcctttttgaagcgttgcgccgagctaaaagttagcggtctg
gtgatccccgatttgccatacgaaagtcgcgctgaaattgtgccgtttgcagaaaagtat
ggcattgatattatcccgttaatcacgccgacttctggccaccggatcgaaaaaattgcc
aaaagtgcttctggtttcatctacgtggtttcctctgtgggcatcaccggtgaacgggac
gaatttttcactggtctaaaaacgttggttacggaaatcaaacgctatactgatgtgcca
acagcaatcggattcggtatccataccccgcaacaagcccaaaccatggcgtcgattgcg
gatggcgtcattatcggcagcgccatcgtggacattgtcgccaaggaagcgcaaaacgcc
cccgctgcgattgagcagtttacaaaggcgattcgggcagcggttgatacgcaaaagcaa
accgagtctgtcgttagtaggaatgcttaa

DBGET integrated database retrieval system