KEGG   Lactobacillus rhamnosus GG: LRHM_0101Help
Entry
LRHM_0101         CDS       T02100                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01130  Biosynthesis of antibiotics
lrg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LRHM_0101
Enzymes [BR:lrg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LRHM_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth QRPTase_C IMPDH DHO_dh PDZ NMO ThiG Pantoate_transf Dus
Motif
Other DBs
NCBI-ProteinID: BAI40628
Position
complement(105711..106490)
Genome map
AA seq 259 aa AA seqDB search
MILDDLVAATRIRLARRQQHQSLTELKRIVAHQPPTTKSDFLTTLKQPGLQVIAEVKKAS
PSKGTIVADFPYMAIAQAYEQAGVDAISVLTEPDYFNGHLRYLKTISQQVSVPTLRKDFT
IDPYMIYEAKANGASIILLIVAILTDQQLRTFRQLAEDLGMQAIVEAYTAEEVTRALQSG
AKIIGINNRNLKNFQVDFTNSLKLRAMVPDSIPVIAESGIQTQQDVEKLAAAGFNAVLIG
ETLMRSKHKRELITAFRGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctcgtcgcagcaaccagaatccgccttgctcgccgccaacaacac
caatccttaactgaactaaaacgtatcgttgcccatcaaccaccgaccacaaaatcagac
ttcctcaccaccttaaagcagcctggtttgcaagttatcgccgaggtcaaaaaagcttcg
ccatcaaaaggaacgatcgtggcggattttccttacatggcgattgctcaagcttacgag
caagccggcgtcgatgctatttccgtcctcactgaacctgattacttcaacggccatctt
cgctatttaaagacgatcagccaacaggtctcagtgccgacattgcgtaaagattttacg
attgatccttatatgatttacgaagccaaggcaaatggtgcgtccattattttgcttatt
gttgccatcttaactgatcaacaattacgcaccttccgccaactcgctgaggatctcggc
atgcaagccattgtcgaagcctacaccgccgaagaagtgacccgtgctttgcaatcaggc
gcaaaaatcatcggcattaataaccggaatctgaaaaattttcaggttgattttacaaac
agtctgaaactacgcgccatggttcctgactcgattcctgttatcgccgaaagcgggatc
caaacgcaacaagatgtcgaaaagttagctgcagccggtttcaacgccgtcttaatcggt
gaaaccctcatgcgctccaagcacaagcgggaattaattacggcattcagggggatttga

DBGET integrated database retrieval system