KEGG   Lactobacillus rhamnosus GG: LRHM_0107Help
Entry
LRHM_0107         CDS       T02100                                 

Definition
putative dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LRHM_0107
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LRHM_0107
Enzymes [BR:lrg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LRHM_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112881..113471
Genome map
AA seq 196 aa AA seqDB search
MTLEVVPFSSASSEIDGLKIIHVKMVTDERGTVRELFRQSQHSQVLVNPNMAWKQVNLTR
TKRGAVRGLHGEAMSKLVTVAHGEAFGAYVDTRRDSPTLGSVVTVRLTPGVQVFVPQGVC
NGFQAVADDTEYLYFFDNEWQKGMTGVALTPLDPDLGIEWPIAIKPDNLAQISKKDSEAP
TLKEVLKQLAETRPKE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaagttgttcctttttcatccgcatcatccgaaattgatgggttgaagatt
attcatgtgaagatggtgacggatgagcgcggaacggttcgagagttgtttcgccagagc
cagcattcgcaagtgttagtaaaccctaatatggcttggaaacaggtcaatttgacccgg
actaagcgcggggctgttagagggttgcatggtgaagcgatgtcgaagctcgtcacggtt
gcccatggagaagcatttggtgcctatgtggatacaagacgggacagtcctactttgggt
tccgttgtcacggttcgtttaacgccaggtgtgcaggtttttgttcctcaaggcgtttgc
aatgggtttcaggcggttgccgatgatacggaatatctttacttcttcgacaacgaatgg
caaaagggaatgaccggtgtggcactaacacctttggatcctgatttggggattgagtgg
ccgatcgccattaagcctgataatttagcgcaaatttcaaaaaaagattccgaggcgcct
actttgaaggaagtgctgaaacaactggcagagacgcggccaaaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system