KEGG   Lactobacillus rhamnosus GG: LRHM_0253Help
Entry
LRHM_0253         CDS       T02100                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LRHM_0253
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LRHM_0253
Enzymes [BR:lrg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LRHM_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257354..258907
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQTTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTAAYFTEAILNEARPRHIALFSTIDTVVGPEPDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFKPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHFQVPGHGTVYVDYAHNYASMKALLSFLKRSYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TELATEAFLTTDDPGYEDPANIINEIDLKIDHTKVKVHKVLDRKEAITEAIKASGPKDVV
VVAGKGADPYQKIRGVNTPWPTDMAVVKEVAQSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcttgtattttattattaaaggaacatcacttattaaaaagt
gcggcaattcagaccactgaagatgtcgatatgaccggcattgcctatgattcacgaaaa
gtttccgggccgactttgtttttctgtaaaggagacaaatttcggccgatttatctgtcc
atggccaaagataacggcgccagaacctatgttgccgaaaagccttacgtggaaggtaat
ggtttaaatgccttaatcgtccggaacatcacgaaagcaatggcgattctcagtgcggcc
tttttcgattatccgcaagatgatttgtttgtgattgcttataccggtactaagggcaaa
acaaccgccgcttatttcaccgaggcgattttgaatgaggctcggccacggcacatcgcc
ttgttctccaccattgatacggtggttggtcccgagccggatcaacggttcaaatcgaac
ttaaccacaccggaaagtttagatttattccgggatatgcgcgaagcagttgaaaatggt
atgacgcatttggtgatggaagtttccagtcaggcttatttacgtaatcgcgtctttggg
ctgacttatgatgtaggcttcttcttaaacattacccctgatcacatcggaccaaacgaa
catccgacttttgccaattatctgcataataagctgcagttgttggtcaatgcgcgcaaa
gtagtgattaacgcggaaaccgagcattttgatcaggtctatgcggcagcgaccaccacg
acttatccggagagtatttatttgttcgccagtgctggattcaagcctaagcgcgatgac
attgatattgatttccgatttgatagtcaagaagctgatgtcgccgaaagccgctttacg
ttggtgccggtaacggaaaaagcagcggcgcttaatattggcggccattattcgcttgct
ttaatcggcgacttcaatgaaagtaatgcgacagcagcgattatcggcgccggcctggca
ggtgtggatgcatctgctgcggtgcctggcatcgccaaagtcaaaattccgggacggatg
gaacattttcaggttccgggtcacggtacggtttatgtggattatgcccacaattatgct
agtatgaaggctttgttatcgttcctgaaacgttcctacaaagatccgcgcttgctggtc
gttgtcggctcccctggtgataaaggggtttcgcggcgcccgggctttgccaaagtatta
actgagttggcaacagaagcctttttaacaacagatgatcccggctatgaggatccagcc
aatattatcaatgaaattgaccttaagattgatcacaccaaagttaaggttcacaaggtg
cttgatcgtaaagaagcgatcacggaagcgattaaggctagtggtcccaaagatgttgtg
gttgttgccggtaaaggcgcagatccgtatcaaaaaattcggggcgtcaacacaccttgg
ccgactgatatggccgttgtcaaggaagtcgcccaatcgttacaggaaggctga

DBGET integrated database retrieval system