KEGG   Lactobacillus rhamnosus GG: LRHM_0322Help
Entry
LRHM_0322         CDS       T02100                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrg00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339347..341128
Genome map
AA seq 593 aa AA seqDB search
MTTFSIDHEFMLDGKPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
REGEFDFSGILDIERFLKTAEDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLAAIDRYYTALMPHLVDHQVTHGGNVIMMQVENEYGSYGEDQDYLAAVAKLMQQHGVD
VPLFTSDGPWPATLNAGSMIDAGILATGNFGSAADKNFDRLAAFHQEHGRDWPLMCVEFW
DGWFNRWGEPIIRRDPDETAEDLRAVIKRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFAIQKMIHEELPEVQQAKPLVKPTMAPASHPLTAKVSLFAV
LDQLTKPIAASYPQTQEFLGQYTGYTLYRTQPLISGTDKGTPAKLRVIDARDRVQAYLDQ
KWLATQYQEAIGDDILLPEVEGHHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKGYQQYPLDLNRASRLTFTEGWQPATPAFYKYTFDLTAPQDTYLDCRGFGKGVMLVNG
VNVGRFWEKGPTLSLYVPAGLLHAGKNDVIVFETEGRYAESLKMADHPIFKEP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccttttcgatcgatcatgaatttatgttggatgggaagccgttcaagatccta
tctggtgccattcattattttcgggtgcatccgagtgactggtatcacagcctgtataac
cttaaagctttagggtttaacacggtggaaacctatgtgccgtggaacttgcatgagtat
cgtgaaggcgagtttgattttagcggcatcctcgatattgaacgttttctcaaaactgct
gaagatctcggcttgtatgcgattgtgcggccgtctccttatatctgtgcagagtgggag
tttggcggatttccggcatggctgttgacgaagaagatgcgtctgcgtactgatgatcca
gcttatttggcggcaattgaccgttactataccgcattgatgccgcatctagttgatcat
caagttacccacggcggcaatgtgatcatgatgcaggtggaaaacgagtacggttcttat
ggtgaggatcaggattacttggcggcggttgcgaaactgatgcagcaacacggagttgat
gtgccgttgttcacttcagatggaccgtggccagccaccttaaacgccgggagtatgatt
gatgccggcattctggcaacgggcaacttcggctcggctgccgataagaatttcgatcgg
ttagccgcttttcatcaggaacacggtcgcgactggccactgatgtgcgtggaattctgg
gatggttggtttaaccgctggggtgagccgattatccgccgcgatcctgatgaaaccgcg
gaagatctgcgcgccgtcatcaagcgtggcagtgtgaatctctacatgtttcatggtggt
acaaattttggcttcatgaacgggacgtctgcgcgtaaagaccatgacctgcctcaggta
acatcttacgattacgatgccccgctaaatgaacaaggtaatccaacgccaaagtacttt
gccattcaaaaaatgatccatgaagagcttccagaagttcagcaagccaagccgctggtc
aaacccacgatggcgccagcttcacacccgttaacggctaaagtttccttgttcgcagtc
ttggatcagttaaccaaaccgatcgccgcttcttatccgcagacgcaagaatttctgggc
caatataccggctataccttgtatcgtacgcagccgctcattagtggcactgacaaagga
acaccggccaagttgcgggtgatcgatgcccgtgatcgggtgcaagcttatttggatcaa
aaatggctagcaacccaataccaagaagcaattggtgatgatatcttgttgccggaagtt
gagggacatcatcaacttgatttactggtagaaaacatgagtcgggtgaattacggatcc
aagattgaggcgatcacgcagttcaaagggattcgcaccggtgtcatggttgatctgcac
ttcatcaagggctatcagcaatacccgctggacttgaatcgcgcttctcggcttaccttt
acggaaggctggcagcccgcgacccctgcgttttacaagtacacgtttgatttgaccgcc
ccgcaagatacctatcttgattgtcgtggattcggtaaaggagtgatgctggttaatggt
gtaaatgtcggcaggttttgggagaaaggccccacgttgtcactttatgtaccggcagga
ctcctgcacgccggaaaaaatgacgtcattgtgtttgaaaccgaaggccgctacgccgaa
agcttgaagatggctgaccacccgatatttaaagaaccatga

DBGET integrated database retrieval system