KEGG   Lactobacillus rhamnosus GG: LRHM_0454Help
Entry
LRHM_0454         CDS       T02100                                 

Definition
beta-galactosidase
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LRHM_0454
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LRHM_0454
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LRHM_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476219..479197
Genome map
AA seq 992 aa AA seqDB search
MTTAKLWEQPELTDINRMVPRSHFQTFFPGEDSQPRNYQLLNGTWQFKFLDAPEYAPENF
MNSDFDDQDWDQIPVPSNWQLQGYGKMHYSDLWYNFPINPPFVPSENPTGLYRRTFTVDE
VVDNEQYIIGFDGADSAFKLYLNGEFIGYSKGARLPSEFDVTQALKQGVNTIAVEVVQWS
DGTYLEDQDMWWLSGLFRDVSLYSRPQNGLYDVQVRTYLLKDYRAGELVVTPIVSGTEPL
KIHYELAKDGAKLIDQVLSADASLDVTLDDIQAWSAEAPNLYDLTMTVLQDNEPLEVVRQ
RVGFRQIELNGKTFLVNGKAIKFKGVNMHDYSATKGRVMTRNDFVKNISLMKQNNINAIR
TSHYPKAPYFYDLCDELGMYVIDETDLECHGFELTERYDWITDDPRWKTAYVDRMRRTLQ
RDKNHPSIIIWSLGNESDFGDNFRAMAAYCKREDPTRLVHYEGDFEAEVSDVYSTMYTWL
EHDTKMTMADVLRKTQKPHILCEYAHSMGNGPGNLKEYQDLFYGHEQLQGGFIWEWFDQG
VASQKDGQTYYRYGGDFGDQPNNGNFCIDGLIRPDGNPSTALTEVKKTFEPFQILVRDLP
TQTVTVINRLDFLNSDYFDFGYELEANGQVIADGKLDIPTILPGHQQTVKLNLDLPEFDP
SVIYNLHLVTHLKNKTAWANAGTVLSQSVMTLQRPKHQLNHQTIVALQASENKTTIEIKG
GANAYRFDKIKGTFTLTHDGRVLIHDGIKMNFWRAPIDNDMYLLDDYYNKYFLNLWHEST
REVQLQPQTNGDYVVNLVKQVGTTNSGWYYQITQRYTLHQDGSFDLDVIGKASGKRDMAP
EMLPRIGVKMTLPKDFQQVAYDGLGPTENYSDSHQAAYYSHFTSRVDDLFVNYVKPQENG
NHMDTDRLALMNGQDQLTLTMMKPLNFSVSNYADETLEAAKHTIDLKKSDELNLYLDFRQ
NGLGTNSCGQNQLKRHRCKFDDFELGFNFKIN
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcaaaattgtgggaacaacctgaactaaccgatatcaatcggatggttcct
cgtagccattttcagacattcttcccaggcgaggatagtcagccgcggaattatcagtta
ttaaatgggacttggcagtttaagttcttggatgcgccggaatatgcgccggaaaatttc
atgaacagcgactttgatgatcaggattgggatcaaattcctgtacctagcaattggcag
ctgcaaggttatggcaagatgcattattctgatctgtggtataacttcccaatcaatccg
ccctttgtaccgagtgaaaatccaactgggttgtatcggcgaacctttacggtggatgag
gtagttgataacgaacaatacatcattggcttcgatggggcagattcggcttttaagttg
taccttaacggcgagtttatcggctatagcaaaggtgcccgtttgccaagtgagtttgat
gtcacgcaggcattaaaacaaggtgttaatacaattgccgttgaagtggttcaatggtct
gatggtacgtatcttgaagaccaggatatgtggtggttgagcggcttgttccgtgatgtg
agtttgtattcgcgaccacaaaacgggttatatgatgtgcaggtacgaacctatttattg
aaggattatcgtgcgggtgaactagtcgtcacaccgatagtatccgggacggagccgtta
aagattcattatgaactagccaaagacggggctaaattgattgaccaagttctttctgcc
gatgcttctttggatgtcacgctggacgacattcaggcgtggtctgctgaagcgcctaat
ctttatgatttaacgatgacagtgttgcaagataatgagccgcttgaagtggttcgtcag
cgggtcgggttccgccaaattgagttgaatggcaagacgttcttggtcaatggcaaagca
atcaagtttaaaggcgtcaacatgcatgattacagcgctaccaagggccgagtgatgacg
cggaatgattttgttaagaacatcagcctgatgaaacaaaacaatatcaatgcgattcga
acgtctcactaccctaaagcaccgtatttctacgacctgtgcgatgaacttggtatgtat
gtcattgatgaaacagatttggaatgtcacggctttgagttgactgaacgctatgattgg
attaccgatgatccacgctggaagactgcatatgtagatcggatgcggcggactttgcaa
cgcgataagaatcatccttccattatcatttggtcgttaggcaatgaatcagactttggc
gataattttcgggcgatggctgcatattgtaagcgagaggatccaacgcgactcgtccat
tacgaaggtgattttgaagctgaagtcagcgacgtttattcaacaatgtacacgtggttg
gaacacgatactaagatgacaatggcagatgtattacgtaagacgcagaagccccatatc
ttatgcgaatatgcacactctatgggcaatgggcctggcaacttgaaggaataccaggat
ctcttttacggacatgaacaactgcaaggtggattcatctgggaatggtttgatcaaggg
gtagcatcgcaaaaggatggtcaaacctactatcgttatggtggtgactttggcgatcag
cccaataacggaaacttttgtatagatgggttgatccgcccagatggcaatccgtctacg
gctttaaccgaggtcaagaagacgtttgaaccgttccagatccttgttcgtgatctgcca
acgcaaacggttacggtgattaatcgactggactttctaaattctgattactttgatttt
ggttatgaacttgaagcaaatggtcaagtgattgctgatggcaagcttgatatcccaact
attttgccaggtcaccaacagaccgtgaaacttaatctcgatttgccggagtttgaccct
agtgtcatttataaccttcatttggttacgcatctcaaaaacaagactgcttgggcgaat
gctggaacagtgctttctcaatctgtcatgaccttgcaacggccaaaacaccaattgaac
catcagacaatcgtggcactacaagcaagtgaaaataaaacgacaatcgaaatcaaaggc
ggtgcgaatgcataccggtttgacaagattaaaggtaccttcacattgacacatgatggt
cgtgtcctgattcatgatggcatcaaaatgaatttctggcgcgcccctatcgacaacgac
atgtatctgttagatgactattacaacaaatatttcctgaacctatggcatgaaagtacc
cgcgaagtccaattacagccgcaaaccaacggcgattatgtcgttaatctagtcaagcaa
gtgggcacgaccaatagtggctggtattaccaaatcacacaacgctacacattacatcag
gatggaagttttgatcttgatgtgattggtaaggcaagtggcaaacgtgacatggcacca
gagatgctaccgcgaattggggtaaagatgacgttgccaaaagatttccagcaagttgcc
tatgacggactgggaccaactgaaaactatagtgactctcatcaagctgcctactacagt
cattttacgagtcgggttgatgacctctttgtcaattatgtaaaaccgcaagaaaatggt
aatcatatggacactgatcgattagcactgatgaacggtcaggatcaattaaccttgacg
atgatgaagccattgaacttcagtgtgtcaaactatgcggacgaaactttggaggccgca
aaacacaccattgatttgaagaaatcagatgagctcaatctatatcttgatttccggcaa
aacggacttggcacgaactcgtgcggccaaaatcaattaaagcgtcatcgctgcaagttt
gatgattttgaacttggatttaacttcaagatcaactag

DBGET integrated database retrieval system