KEGG   Lactobacillus rhamnosus GG: LRHM_0730Help
Entry
LRHM_0730         CDS       T02100                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRHM_0730
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LRHM_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759640..760236
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGTIQAVTPAYIVIDVNGIGFRLLVANPYDFEAGKQTRIYVQLIIRENDQTLYGF
ETAADKRTFNQLLSVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDAQPAAATIMPTADQVAPELADALAALVALGYTQRAVDGITDALKAFDA
TTTDAYLREGLRLLSGRA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatactttgaaggcacaattcaggccgtaacgccggcgtacattgtcattgat
gtcaatggcatcggatttcgcctgctggtagccaatccatacgatttcgaagcgggaaag
cagacccggatttatgtgcaactcatcatccgcgaaaatgatcaaacactttacggattt
gaaacagcagcggataaacgaacttttaaccagttgttatccgtcaccggcattggtccg
aaatcagcgttggcaattttggcaaatgtttcaagtggtggcctagcaactgccattgcc
caggatgatgttaaatttttgaccaagtttccgggcatcggtaagaagacggccgctcag
attatcctggatctaaaaggcaaaattacgaccgatgctcaaccggctgccgcaacgatc
atgccgaccgccgatcaagtagcgccggagctggcagatgccttggctgcactggttgcc
ttaggatacacccaacgcgcggttgatggcattaccgatgctttgaaagcctttgacgcc
acgacgaccgatgcttatctgcgtgaaggtttacgcttgttgagcggacgagcataa

DBGET integrated database retrieval system