KEGG   Lactobacillus rhamnosus GG: LRHM_0814Help
Entry
LRHM_0814         CDS       T02100                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LRHM_0814
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LRHM_0814
Enzymes [BR:lrg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LRHM_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861819..862292
Genome map
AA seq 157 aa AA seqDB search
MSIYDFEVTLEDGSKYSLNKYKGRPMLIVNTATKCGFAPQFDGLEALYKKYQKAGLIVLG
FPSNQFKQELADGHAAAEACRMKYGVSFPMHQLIKVNGQQTAPLFKYLKTEAPGELGKSI
KWNFTKFLVDRNGHVVKRFAPKTTPEAIEPAVEELLS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttacgattttgaagtaacgctagaagacgggtccaagtattcattgaataaa
tataaaggccggccgatgctgatcgtcaatacggcaaccaaatgtggttttgccccgcag
tttgacggtttggaagcattgtataaaaagtatcaaaaagcaggtttgatcgtgttagga
tttccatcaaatcagtttaagcaggagctggcggatggacatgctgcagcagaggcatgt
cgaatgaagtacggggtcagctttccgatgcatcaactgatcaaggtcaatggtcagcag
acggcgccgttgtttaaatatttaaagactgaggctccaggcgaattgggtaagtcgatc
aaatggaacttcaccaagtttttggtcgatcgcaatgggcatgtcgtgaagcgctttgca
cctaaaacaactcctgaagcaattgagccagcggttgaggagctgttatcctaa

DBGET integrated database retrieval system