KEGG   Lactobacillus rhamnosus GG: LRHM_0892Help
Entry
LRHM_0892         CDS       T02100                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRHM_0892
   01230 Biosynthesis of amino acids
    LRHM_0892
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHM_0892
   00051 Fructose and mannose metabolism
    LRHM_0892
   00562 Inositol phosphate metabolism
    LRHM_0892
Enzymes [BR:lrg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LRHM_0892
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LRHM_0892
  Exosomal proteins of bladder cancer cells
   LRHM_0892
  Exosomal proteins of melanoma cells
   LRHM_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940607..941362
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQAFLDAVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMGVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
DSFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaccattcattgctggtaactggaaaatgaataagaatcctaaggagacgcaa
gccttcttagatgctgttaagggtaagttacctgatgcaagcaaagttgaaacagtcatt
ggcgcacctgccattgatctaacgacgctggttgccggtgcagaaggtactcctttgaag
acagcggcggaaaactgctactttgaagacgaaggtgcttttaccggcgaaaccagcccg
aaagccttaaaagaaatgggcgttgattacgtcattatcggtcacagtgaacgtcgcggt
tatttccacgaaaccgacgaagatatcaacaagaaggctaaggccatctttaagaacaat
cttttgccgattatctgctgtggtgaaagtttggctcagcgtgaagccggtcaaaccgaa
gattgggttgcttctcaaatcgaagcagctttggcaggcttaagtgccgaccaagttaag
gtttcggttttggcttacgaaccaatctgggctatcggcactggtaaaacagcaactgca
gatcaagcacaagaagttgttgctcacatccgtgcaaccgttgagaagttgtataataaa
gatacggcagatgctgttcggattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatattgatggtggcttagttggtggcgcttcgatggatcct
gacagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system