KEGG   Lactobacillus rhamnosus GG: LRHM_0892Help
Entry
LRHM_0892         CDS       T02100                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00010  Glycolysis / Gluconeogenesis
lrg00051  Fructose and mannose metabolism
lrg00562  Inositol phosphate metabolism
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01130  Biosynthesis of antibiotics
lrg01200  Carbon metabolism
lrg01230  Biosynthesis of amino acids
Module
lrg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrg_M00002  Glycolysis, core module involving three-carbon compounds
lrg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHM_0892
   00051 Fructose and mannose metabolism
    LRHM_0892
   00562 Inositol phosphate metabolism
    LRHM_0892
Enzymes [BR:lrg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LRHM_0892
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LRHM_0892
  Exosomal proteins of bladder cancer cells
   LRHM_0892
  Exosomal proteins of melanoma cells
   LRHM_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAI41419
Position
940607..941362
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQAFLDAVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMGVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
DSFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaccattcattgctggtaactggaaaatgaataagaatcctaaggagacgcaa
gccttcttagatgctgttaagggtaagttacctgatgcaagcaaagttgaaacagtcatt
ggcgcacctgccattgatctaacgacgctggttgccggtgcagaaggtactcctttgaag
acagcggcggaaaactgctactttgaagacgaaggtgcttttaccggcgaaaccagcccg
aaagccttaaaagaaatgggcgttgattacgtcattatcggtcacagtgaacgtcgcggt
tatttccacgaaaccgacgaagatatcaacaagaaggctaaggccatctttaagaacaat
cttttgccgattatctgctgtggtgaaagtttggctcagcgtgaagccggtcaaaccgaa
gattgggttgcttctcaaatcgaagcagctttggcaggcttaagtgccgaccaagttaag
gtttcggttttggcttacgaaccaatctgggctatcggcactggtaaaacagcaactgca
gatcaagcacaagaagttgttgctcacatccgtgcaaccgttgagaagttgtataataaa
gatacggcagatgctgttcggattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatattgatggtggcttagttggtggcgcttcgatggatcct
gacagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system