KEGG   Lactobacillus rhamnosus GG: LRHM_0970Help
Entry
LRHM_0970         CDS       T02100                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LRHM_0970
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LRHM_0970
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LRHM_0970
Lipid biosynthesis proteins [BR:lrg01004]
 Fatty acid synthase
  Component type
   LRHM_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1021067..1021852)
Genome map
AA seq 261 aa AA seqDB search
MKKIWLGLGVLLLLVAAGCGVSRQAAKSTSHPSASARSRQASAASTPPRPTRLARLKAKS
KAQLVYAPFGDSLSVGLFADKKATRFTSLFARQLARLTGKTVTEAGIAEVGKTATNLGVP
ALPQLVAQHPDVITIEFGTNDAVGGATSTALAAYQQALTTIVTTLQKETSAQLILMTTWS
PNQGPYVNADLKFDAVVKAVGQTYQVPVVDLATIWQGHDDVTGPAGTVIPDFTANGPRDT
FHPNQRGHDQIAAQLIKTLEE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttggttgggattgggtgttttactattgttagtagcggccggctgtggg
gtttcgcggcaagctgctaaatcaacaagccacccctctgcatcggctcgcagtcgtcag
gccagcgccgcttcaacgccgccgcgcccgactcgattagcacgattgaaggccaaaagc
aaagcacaactggtttatgctccttttggcgacagtctttccgttggcctttttgccgat
aaaaaagccactcgttttacgtcgctttttgcccggcagctggcccgattaaccggaaaa
accgtcaccgaagccggcattgcggaagtgggaaaaacggctactaacttgggcgtcccc
gctttaccgcaactcgttgcccagcatccggatgtgatcactattgagtttggcaccaat
gacgctgtcggtggcgcaacctcaactgcgctcgctgcctatcaacaagcactgacaacc
attgtcaccacgttgcaaaaagaaacctcggcacaactgatcctcatgacaacctggtca
ccaaatcaagggccctacgttaatgccgacttgaaattcgatgccgttgttaaagcagtg
ggccaaacctaccaggtaccggtcgttgacttggcaaccatctggcaaggtcatgatgat
gtcaccggaccggctggcactgtcattccggatttcactgccaatggcccccgggatacg
ttccaccctaatcaacgcggccatgatcaaattgctgctcaactcattaaaactttggag
gaatga

DBGET integrated database retrieval system