KEGG   Lactobacillus rhamnosus GG: LRHM_0970Help
Entry
LRHM_0970         CDS       T02100                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lrg01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1021067..1021852)
Genome map
AA seq 261 aa AA seqDB search
MKKIWLGLGVLLLLVAAGCGVSRQAAKSTSHPSASARSRQASAASTPPRPTRLARLKAKS
KAQLVYAPFGDSLSVGLFADKKATRFTSLFARQLARLTGKTVTEAGIAEVGKTATNLGVP
ALPQLVAQHPDVITIEFGTNDAVGGATSTALAAYQQALTTIVTTLQKETSAQLILMTTWS
PNQGPYVNADLKFDAVVKAVGQTYQVPVVDLATIWQGHDDVTGPAGTVIPDFTANGPRDT
FHPNQRGHDQIAAQLIKTLEE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttggttgggattgggtgttttactattgttagtagcggccggctgtggg
gtttcgcggcaagctgctaaatcaacaagccacccctctgcatcggctcgcagtcgtcag
gccagcgccgcttcaacgccgccgcgcccgactcgattagcacgattgaaggccaaaagc
aaagcacaactggtttatgctccttttggcgacagtctttccgttggcctttttgccgat
aaaaaagccactcgttttacgtcgctttttgcccggcagctggcccgattaaccggaaaa
accgtcaccgaagccggcattgcggaagtgggaaaaacggctactaacttgggcgtcccc
gctttaccgcaactcgttgcccagcatccggatgtgatcactattgagtttggcaccaat
gacgctgtcggtggcgcaacctcaactgcgctcgctgcctatcaacaagcactgacaacc
attgtcaccacgttgcaaaaagaaacctcggcacaactgatcctcatgacaacctggtca
ccaaatcaagggccctacgttaatgccgacttgaaattcgatgccgttgttaaagcagtg
ggccaaacctaccaggtaccggtcgttgacttggcaaccatctggcaaggtcatgatgat
gtcaccggaccggctggcactgtcattccggatttcactgccaatggcccccgggatacg
ttccaccctaatcaacgcggccatgatcaaattgctgctcaactcattaaaactttggag
gaatga

DBGET integrated database retrieval system