KEGG   Lactobacillus rhamnosus GG: LRHM_1014Help
Entry
LRHM_1014         CDS       T02100                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LRHM_1014
   00052 Galactose metabolism
    LRHM_1014
   00500 Starch and sucrose metabolism
    LRHM_1014
   00520 Amino sugar and nucleotide sugar metabolism
    LRHM_1014
Enzymes [BR:lrg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LRHM_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071150..1072070
Genome map
AA seq 306 aa AA seqDB search
MSVKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGK
QKRSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAK
SFVGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKE
VSKDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTL
NQTQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGNPVG
KPANKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctg
ccagcaaccaaagctttagctaaggaaatgttgccgattgtcgacaaaccgaccattcaa
tttatcgttgaagaagctaaggccagtgggattgaggatattctgattgttgagggtaaa
caaaaacgctctattgaagatcattttgactcagcacctgagctggaacagaatctgaaa
gaaaaacataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaac
ttattcttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaa
tcgtttgttggcgatgagccattcgtggtcatgttgggtgatgacctgatgaatgacaaa
gtgccgttgaccaagcaattaatcgatgaatacgataagacccatgcgtccattcttgcc
gttaaaaaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaa
gtttccaaagacctctataacgttaagaaatttgttgaaaagccagccgttgctgatgcc
ccaagtgacttggcaatcatcggccgctacctgctgaccccggaaatttttgatattctt
gataatcaaaaaccaggcaaaggcaatgaaattcagttaaccgatgcgatcgatactttg
aaccaaactcagcgcgtctttgcacatgagtttaaaggtgatcgctatgatgttggtaat
aagttcggatacgtcaagaccaatgttgaatatggtttgacccatccggaagtaaaagat
gaactccgcgcgtacatccttgatctggctgctaagttgcagtcaggcaatcctgtgggg
aagccggcaaataagaaatag

DBGET integrated database retrieval system