KEGG   Lactobacillus rhamnosus GG: LRHM_1140Help
Entry
LRHM_1140         CDS       T02100                                 

Definition
(GenBank) putative peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00300  Lysine biosynthesis
lrg01100  Metabolic pathways
lrg01120  Microbial metabolism in diverse environments
lrg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LRHM_1140
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LRHM_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAI41667
Position
complement(1182120..1183244)
Genome map
AA seq 374 aa AA seqDB search
MTDPIAFLQKLIQIDSANGNELAVARVLQAELEAADIPTKLIPYKDDRVNLVAQLNHGDR
VLGFTGHEDVVSPGDENAWTYPPFSGKIVNNTMYGRGTDDMKSGLAAMTLALIHLKQSGF
AHPLRFMATVGEEFGAMGARQLTEQGYADDLAGLVVGEPTNKLLKYAHGGTVNYEIDSEG
VSVHSSRPEKGVNAIEGLVAFSTREPHAFDQAPDDPDLGPFRHSITVIKGGDQVNTIPAH
AYLRGNLRPTPAANIELVVGLLEKLVDQANKATAANLTLNVLHRFLPVHSDKNGHLVTTA
NEAIAAVTGKPAELAVAFGGTDASEFIRSDNQFDVIVYGPGDNHFSHQIDEHVDLDSYTT
AIKTYEEIAKRFFA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcccattgcgtttttgcaaaaactaatccaaattgactctgcaaatggaaac
gaacttgcagtagcccgcgttttgcaagctgaactcgaagcggccgatattccaaccaaa
ttgatcccatacaaagatgatcgggtcaatttagtcgcccagctcaatcacggtgaccgc
gtattaggcttcaccggccatgaagacgtggtgagtcccggcgatgagaacgcctggacc
tatccgcctttttccggaaagatcgtgaacaacaccatgtacggtcgcggcaccgatgat
atgaaaagtgggctagcagccatgaccttggcactgatccaccttaagcaaagcggcttt
gcccatccgctgcgtttcatggccacggtcggtgaagagtttggtgcaatgggagcgcgc
caactcaccgaacaaggttatgccgatgacttagccggactcgtggtaggcgaaccaacg
aacaaattgctaaaatacgcacacggcggaacggttaactacgaaattgacagcgaaggc
gtttccgtccacagctcccggccggaaaaaggcgttaacgcaattgaagggttggtggca
ttttctactcgcgaaccgcacgcctttgatcaggcccctgatgatcctgaccttggtcca
ttccgccactccattaccgtgatcaaaggcggcgatcaagtcaacaccattcctgcccat
gcatacttacgcggcaacttgcgcccgactcctgcagcaaatatcgaattagtcgtcggg
ttattggaaaaattagtcgatcaggcaaataaagccaccgccgctaacttgacgttgaac
gttttacatcgttttttgccggtacactctgacaaaaacgggcatctcgtgacaaccgct
aacgaagccattgccgctgtgactggtaagccagccgagttagcggtggcttttggcgga
accgacgcgtcagaattcatccgttccgataaccagtttgacgtgattgtctatggtccc
ggcgataatcatttcagtcatcagattgacgaacatgttgatttagatagctacacgaca
gcgattaaaacttacgaagaaattgccaaacgcttttttgcctga

DBGET integrated database retrieval system