KEGG   Lactobacillus rhamnosus GG: LRHM_1254Help
Entry
LRHM_1254         CDS       T02100                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRHM_1254
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LRHM_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302452..1304917
Genome map
AA seq 821 aa AA seqDB search
MDRHEDSVTGRVKSIFFQNPTNFFKILLIDITATTITWTEQDIVVTGTFGDIKEDETYTF
TGHVVDHPKYGQQFQADNYHVDRPTNKTGLINYLSSDKFPGIGPKTAEKIIDKLGVDAID
RILDDPESLKGLGISAAKQKMLVTNLKTNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LEVIKQNPYQLINDIDGIGFTRADQIAAKLAIAPDSQLRLGGAVMDTLQRLTDGEGDTFV
ELKTLVTQTLDLLERARQVAVNPEAVGQAIVTLAKDNALVAEGKRIFPKRLYDSEWQIAR
QLKGLADAGSAAKQPALAEIKQTLAAVQEETGIAYDEVQKKAIITALQSPIFLLTGGPGT
GKTTVTDGIVRTYAQLHDLSLDRHEYTPDDPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNDLPDGLLIIDEMSMVDTYLFRTLLTALHPGMQIVLVGDKDQLPSVG
PGQVFADLLRSQALPHAALTHIHRQDADSSIIPLAHAVNAGRLPDDFTRPQVDRSFLPCS
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQDILNPKRSARTKTV
HFGETEYRIGDKILQLVNDPNQNVFNGEIGQIVGITLAKEAASKTDELTIDFDGNEITYK
RSDFSKITLAYATSIHKAQGSEFPMVILPLTMQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFETAVGEIAVNRHTGLVQRLQQAFGMTVSQPDVEKPTPATEVSQNTGQIDTNPSDLDN
GISTDESNNYQLTPALVASQRIDPMIGMNGVTPQMFMTKEK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcatgaagatagcgttactggccgggtcaaaagtattttctttcagaatccg
actaacttttttaaaatcctgctgattgatatcacggcaaccacgattacctggacggag
caggatattgtggtgaccggtacgttcggggatattaaagaagatgagacgtacacgttt
accgggcatgtcgtggaccatccgaaatatggccagcagtttcaagcggataattaccat
gtggatcggcctacgaataaaacgggattgatcaattatcttagttccgacaagtttccg
ggaattggccccaaaacagcggagaaaatcattgacaagctcggagttgatgcgattgat
cgtattttggatgaccctgagagcttaaaaggattggggatttcggcggccaagcagaag
atgctggtcaccaatctgaagacgaaccagggaatggaacgggtcatcatcggccttaat
gactacggcttcaccagtaacatggctggccgaatttatcagcaatatcaaaatgatgcg
ctggaagtcattaagcaaaatccgtatcagttaatcaatgatattgacggtatcgggttt
acgcgggccgatcagattgccgccaagttagcgattgccccggattcgcaactgcggctc
ggcggtgcggttatggataccttacagcgtttgacagacggtgaaggcgacacttttgtc
gagttaaaaacgttggtcacccagacgcttgatttactggagcgagcgcgtcaggttgca
gtgaaccccgaagcagtcggccaggcaatcgtcactttagccaaggacaatgcgctggta
gcggaaggtaagcgcatttttcctaaacgactttatgattccgaatggcagattgcccgg
cagttaaaaggactggcggatgccgggagcgctgccaagcaacctgcactggccgaaatt
aaacaaacattggccgccgtacaggaagagactggcattgcttatgatgaggtgcaaaaa
aaggcgattatcactgccttgcagtcgccgatttttcttttaaccggcggccccggaacc
ggaaagacaacggtgacggacgggattgtccgcacttatgcgcaattgcatgatttatcc
ttagatcgtcacgaatacacgccggacgatcctttcccgattatgctagcagcaccgact
ggccgggctgctaaacggatcagtgagacgacacagttaccggcaagcacgattcatcga
ctattgggattgggcgtggatacgcaggagtttgcgcctaatgatctcccggacggcctt
ttaattattgatgaaatgtcgatggtcgacacgtatctttttcgaacgttattgacggcg
ctgcacccgggtatgcaaattgtgttggttggtgataaagatcagctgccaagtgtcgga
ccgggacaggtttttgctgatttgttacgcagccaggctttacctcacgcagcgttaacc
cacattcaccgccaggacgcggacagttcgattattccgttggcgcatgcggtcaatgcc
gggcgcttgccggatgacttcacccgcccgcaagtggatcggagctttttgccgtgctct
cccagtcaagttccggaagtggtcgggcaggtggttcagcgtgccgcggttaaacagttt
tcgattgcggacattcaggtgcttgcgccaatgtatcgcggaactgcggggattgatcgg
ttgaatccattgttgcaggatattttgaacccgaaacgcagcgctcggacaaaaaccgtt
cattttggcgaaaccgagtatcgaattggcgataaaattctccaattggtcaacgatccg
aatcaaaatgtgtttaatggcgaaattggccagattgtcgggatcacacttgccaaagag
gcggccagcaaaaccgatgagttgacgattgattttgacggcaatgaaataacgtataaa
cgcagcgacttcagcaaaatcaccttggcttatgcgacttcgattcacaaagcgcaaggt
agcgagtttccaatggtgattttgccattaaccatgcagagtcgccggatgctgcgccgg
aacctactttatacggccattacccgggcaaaatcgtttttgattctggtgggcgagctc
gctgcatttgagaccgcagttggcgaaattgcggtaaatcggcatacgggtttagtccag
cggctgcaacaagcgtttggtatgaccgtttctcagccggacgtagaaaagccgacgcct
gcaactgaagtcagccagaataccggacaaattgacactaacccgtctgacttggataat
ggaattagtactgacgaatcgaacaattatcagctaacccctgcattggtggcttcacag
cggattgatcctatgattgggatgaatggtgtgacgccacaaatgtttatgacgaaggag
aaataa

DBGET integrated database retrieval system