KEGG   Lactobacillus rhamnosus GG: LRHM_1318Help
Entry
LRHM_1318         CDS       T02100                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRHM_1318
   01230 Biosynthesis of amino acids
    LRHM_1318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHM_1318
   00030 Pentose phosphate pathway
    LRHM_1318
   00051 Fructose and mannose metabolism
    LRHM_1318
   00052 Galactose metabolism
    LRHM_1318
  Energy metabolism
   00680 Methane metabolism
    LRHM_1318
Enzymes [BR:lrg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LRHM_1318
Protein phosphatases and associated proteins [BR:lrg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LRHM_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373993..1374952
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMSESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAYGDF
QLRATVLGHIVRGGAPSARDRVLASQMGAYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggtgatgctccaggcatgaacgccgcggtt
cgagccgttgctcgcaaggcgatgcatgaaggccttgaagtatatggcatcaattatggc
tttgccggtttagtggccggtgacatttttaaaatgagcgagtcaacggttggtgacaag
atccaacgtggcggtaccatgctgtactccgcccgttatccgcagtttgctcaagaagaa
ggccaattgcgcggggttgaacagcttaacaagttcggtattgaagcactggttgttatt
ggcggcgatggttcataccacggtgcattggcactaacccgtcacggtttcaatacaatc
ggcttacccggcacgattgataatgatattccgtacactgatttcacgatcggatttgat
acggcggttaataccgtggttgaagcggtggatcggttgcgggatacggctgcatcccat
gaacggacctttgtcattgaggttatgggacgtgaagcaggcgacatcgcattgtggtct
ggcgttgccggcggggccgaagatgtcattatccccgaacacgacttcgatgttaaaaag
attgcttcgaagttacaaagttcccgtgaacgtggtcaaaagcatgcggttatcttgctg
gctgaaggcgtgatgcacgccgatcagtttgccaaggaacttgctgcctatggtgatttc
cagttacgtgctaccgttttaggtcatatcgttcgtggtggtgcgccatcagcacgtgac
cgcgtattggcttcccaaatgggtgcttacgccgttgaactcttgctgcaaggcaagggt
gcgttggcagtcggcattgaaaataacaaaattacggcgcatgatgtccggactttgttt
gatgccaagcaccacgccgaactttcgctctacaccttggcggaagagttaacattttaa

DBGET integrated database retrieval system