KEGG   Lactobacillus rhamnosus GG: LRHM_1342Help
Entry
LRHM_1342         CDS       T02100                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LRHM_1342
   00670 One carbon pool by folate
    LRHM_1342
Enzymes [BR:lrg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LRHM_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397822..1398313
Genome map
AA seq 163 aa AA seqDB search
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAPGAVVVHDVAAVFAYAKQHPDQELVIAGGAQVFTAFRDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatttttatgggcacaggatcgcgatggcttaattggcaaagatggtcatttg
ccatggcatttacctgatgatttacattatttccgggcgcagacagttggtaagatcatg
gtcgttggtcggcgcacctatgaaagttttcctaaacgtcctttacctgagcgaaccaat
gttgttttgactcatcaggaagactatcaagcgccaggtgccgtggtcgtgcatgatgtt
gcggcggtttttgcttatgctaagcagcatcccgatcaggaactggtcattgctggtggt
gcgcaggtctttacggcgtttagagatgatgtcgatacgttactggtgacacggttggct
ggcagttttgaaggcgacacgaaaatgattccattaaactgggatgattttaccaaagtc
tccagccgcaccgttgaagataccaatccggcgctgacgcacacttatgaggtttggcaa
aagaaggcttaa

DBGET integrated database retrieval system