KEGG   Lactobacillus rhamnosus GG: LRHM_1949Help
Entry
LRHM_1949         CDS       T02100                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LRHM_1949
Enzymes [BR:lrg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LRHM_1949
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRHM_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069974..2072037)
Genome map
AA seq 687 aa AA seqDB search
MIQGLKDWLYLFNSGQDFQSYNRFGAHEVSPGKWSFLVWAPHAQQIKVVGDFNDWRGSPL
TRQGETGCWYGELAAQKGQLYKYKVVGPDGATHEKIDPYGFGFERKPGSAARLLDIPRIK
WHDDSWLSKRSKWRPYAEPLAIYEVHLGSFIRDTHAGPDGGYMTYQDAIDKLIPYVKELG
YTHIEFLPLMEHPLDASWGYQLMGYFAPTSRFGDPADFLRFVDAAHVAGLGIIMDWVPGH
FIKNTDMLAQFDGTPTFEYTDPHRAENVRWGTWNFDLGKAQVQSFLISSAMYWLDHCHLD
GLRVDAVSNMLYMDYDAGKENDRNRFGGRDNLEGIAFLKQLNTKVFAKHPDVLMMAEESS
AYPKVSAPINIGGLGFNYKWNMGWMNDTLKFFEEDPVYRHSDMNLLTFSFMYMYNEQFVL
PFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMYVWQMTFPGKKLLFMGSEWGQFLEWRDW
SELEWVDLKDPMNHKMQTFTKTLNHIYTNRPSLWQQDHEPLGIKITMADEPDVMSYIRYG
KQKDDFTVVALNFVPVQKDHFRVPVPSLGTYTILLNTESLDFGGTWTKWQATLTAQLGDQ
YGEPAWLDVILPAMGALLIVPKKLQPLPKKLATKHHQRPAALSGKQPPLAISNQERPAIS
HQRDWGTAPARTQPVKKDLIVKKHKKK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggattaaaagattggttatacctcttcaactcagggcaggattttcaaagt
tacaatcggtttggtgcccatgaagtttcacctggcaaatggtcgtttctcgtctgggcg
ccacatgcccaacagattaaagttgtcggcgattttaacgattggcgcggcagtccgctg
acccggcaaggagaaaccggctgttggtacggcgaactcgcagcccagaaaggacagttg
tataagtacaaggtggtcggtccggatggggccacacatgaaaagattgatccatatggg
tttggatttgaacgtaagccaggcagtgctgcccgactgcttgatattccgcgaatcaaa
tggcatgacgattcgtggctaagcaaacgcagtaagtggcggccatatgctgagcccctg
gcaatttatgaggtgcatttaggttcttttatccgcgacacgcacgccggtccggatggc
gggtatatgacctatcaagatgcgattgataagctgattccttacgttaaggaattgggg
tatacccatattgagtttttgccgttgatggagcatccgcttgacgcttcatggggctat
cagctgatgggttactttgccccgacaagccgttttggcgacccggcagatttcctcagg
tttgtcgatgctgctcatgtggccgggttgggcatcatcatggattgggtgccaggacat
ttcattaaaaataccgatatgctcgctcaattcgatggtaccccaacgtttgaatatacc
gatccgcaccgcgccgaaaatgttcgctggggaacctggaattttgatttaggcaaagca
caagtgcaaagttttctgatttccagcgcgatgtattggcttgatcattgtcatcttgat
gggctgcgtgttgatgcggtttcgaatatgctgtacatggattatgacgccggcaaagaa
aatgatcgcaatcggtttggcggccgcgataatcttgagggcattgcctttttgaagcag
ctgaatacgaaggtgtttgccaagcatccggatgttttgatgatggcggaggaaagttca
gcctatcctaaggtgtcagcgccgattaatatcggtggcctagggttcaattacaaatgg
aacatgggctggatgaacgatacgctgaagttctttgaagaagatccggtttatcgccac
agtgatatgaatttattgacgttttcatttatgtatatgtataacgaacagttcgtttta
ccgttttcccacgatgaagtcgttcacgggaagaagagcctgatgcacaagatgcctggc
gatcggtacaaccagtttgccaatctacgcaccatgtacgtgtggcaaatgacgtttccg
gggaaaaagctattattcatgggcagtgaatggggtcaattccttgaatggcgtgactgg
agcgagcttgagtgggttgatttgaaagacccgatgaaccataaaatgcaaacctttacg
aaaacgctgaatcatatctatacaaaccgaccgagtctttggcaacaggatcatgaacca
cttggcattaagatcacaatggcggatgaaccggatgtcatgagttacatccgttatggc
aagcaaaaagatgacttcacggtggttgcgttaaattttgtcccggtgcaaaaagaccac
ttccgcgtgccagtcccaagcttgggcacgtacacgattcttttaaatacggaaagcctt
gattttggcggtacctggaccaagtggcaggcgactttaaccgcccagctaggtgatcaa
tacggcgagccggcttggttagatgtgattttgccagcaatgggcgcgttactaattgtt
cccaaaaaactgcagccgttgcctaaaaagttggcgaccaagcaccatcagcggccagcc
gcactttccggaaagcagccgccactggcaatttcaaatcaggaacgaccggccatcagt
catcaacgcgattgggggacggcgcctgcccgaacgcaaccggtgaaaaaagacctgatt
gttaagaagcataagaagaagtga

DBGET integrated database retrieval system