KEGG   Lactobacillus rhamnosus GG: LRHM_1998Help
Entry
LRHM_1998         CDS       T02100                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LRHM_1998
  Lipid metabolism
   00561 Glycerolipid metabolism
    LRHM_1998
   00600 Sphingolipid metabolism
    LRHM_1998
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LRHM_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2124986..2127208
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPQKQLFHLHNDTFSYIIQVIRGYLVKRYCGPALERFSGTAKLEDFSHAFNIQN
DAAPFSLTTLPLEYSTLMGGDYRTPGYAVRNGHGQLIGNLKFHDFQILAGNKNFNGTLPT
ARTPHGQTLVITMHDETDTLAVNLKYTIVGDLPVLLKQVAYHNLSDDTLTITHAASLQLD
FDDHAYDLITLTGAHLSEASVTRQPLTPGKKSIASNYGASGPQGVPATILAAPATDDFAG
EALGMALLWSGNFSYTAQVDQFGNSRLVMGLNPELFSWQLKPGEPFVTPEAAVAYTTNGL
NDLSHIFHRFFADHVMPLPRKNLIEYNTWESTYFDVSEAKVRAEIPKAEALGVELIVIDD
GWFKNRPNDAGQLGDWVPDPVKFPRGLRPIADALHERGLAFGLWVEPEMITENSELYAKH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLIKVLTDLVRTNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVAYRYTRGLYRVLKTLRDTFPDLLIENCSSGGGRLDGGMLAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKTFVSHFTMSPNLQDSRVTPLQTRALLSLVGVTGIECPP
SQLSDAEAAAVKASFVFYKANRTELQNGSLYRLHPSHPNQDQVCWLITNEAKTKALVLTS
AGVVSPIPHYQHVLLHYLNPEVSYQINDKATATGAELNYAGITLPLAHGDFSATLMTLRV
VSHLPQTTALPGGDIGELRF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatagaatacgacccgcaaaaacagcttttccacctgcataacgatacgttt
agctatatcattcaggtgattcgcggctatttggtcaagcggtattgcggaccggcgctt
gaacgtttttccggtactgccaagctggaagatttcagtcatgcgtttaacattcaaaat
gatgcggcaccgttttcgctcacgaccttgccgcttgaatatagtacgctgatgggcggg
gattatcggacgcctggctatgccgttcgcaatgggcatggacaattgatcgggaatctg
aagtttcatgattttcagattctggcgggaaataaaaacttcaatggtactttgccgacc
gcgcgcaccccgcatgggcagacgctggtgatcacgatgcatgacgaaaccgatacgctg
gcggtgaatctcaagtacaccatcgttggcgatctgcctgtcctgcttaagcaagtggct
taccataatctaagtgacgacaccctcacgattacccatgcagccagcttgcaactggat
tttgatgatcacgcttacgatctcattactttgacgggcgcccatctcagcgaagccagc
gtcacccggcaaccgctcacaccgggtaaaaagtcaatcgccagcaattatggtgccagt
ggtccacaaggggttccggcaacgattctggcggcaccggcaactgatgactttgcaggc
gaggcgcttggtatggcgctgttgtggagtggtaattttagctacaccgcgcaagtcgat
cagtttggcaacagtcggctggtgatgggcctgaatccggagctcttttcctggcagctg
aagcctggtgaaccgtttgtgaccccggaagcagcggtggcgtacacgaccaatggcttg
aatgatctcagtcatattttccaccgcttttttgccgatcacgtcatgccattgccgcgg
aaaaatctgatcgaatataacacttgggagtccacgtactttgatgtcagtgaagccaag
gtgcgcgcggaaatccctaaggccgaggcgctcggagtcgaattgattgtgattgatgat
ggctggttcaaaaatcggccgaatgatgccggtcagctcggcgattgggtgcctgatccg
gtcaagtttccgcgcgggttgcggcccattgccgatgccttgcacgagcgcggactagca
ttcggtttatgggtcgaaccggaaatgataactgaaaatagtgagttatatgccaaacat
ccagactgggcgatgcaatatgttggccaaaagccgttacgttcgcgcaatcagttaatt
ctggatcttagccagcgaattgttcaggatcatctgattaaggtgctaaccgatttggtc
cggaccaatcatattgattatttaaaatgggattacaaccgtcatttcagccagcccggc
agtccggtactgccacctgatcaacaaggcgaagtcgcctatcgttacacccgcggcttg
tatcgggttttgaaaacattgcgcgacacttttcccgatttgcttatcgaaaattgttcg
tcaggcggtggccggttggatggcgggatgctggcctatacggatcaaacctggaccagc
gatttcaccgatcccgtttaccggatgaaaattatgaacggcttctccttattcttcccg
cttaaaaccttcgtctcgcatttcacgatgtcaccaaatttgcaggactcgcgggtgacg
cctttgcaaacgcgggcgctgcttagtctggtgggcgttactgggattgagtgtccgcca
agccagttgagtgacgctgaagccgcggcggttaaagccagctttgtcttttacaaagct
aatcgcacagaattgcaaaatggcagtctttatcggctgcatcccagtcatccgaatcag
gatcaggtatgctggctgatcaccaacgaagccaaaaccaaggcgctcgtcttaacgtca
gctggcgtggtttccccgattccgcactaccaacatgtgctgttgcattatctcaacccg
gaagtatcctaccagattaatgacaaggccacggccaccggtgctgaactcaattatgcc
gggatcactttaccgctggcgcatggtgatttttccgctaccttaatgacgttgcgcgtg
gtgagtcacctgccacaaaccacggcactgcctggtggcgacatcggtgaattgcgattt
tag

DBGET integrated database retrieval system