KEGG   Lactobacillus rhamnosus GG: LRHM_2071Help
Entry
LRHM_2071         CDS       T02100                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRHM_2071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHM_2071
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LRHM_2071
Enzymes [BR:lrg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LRHM_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2215629..2217143)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDQRVSKTGQQAIKQGISEEGGLFVLPHLTDYRLNLQNLLGKDYETIAQNVLTT
LLPDFNTAALKKAIQFAYHKNFSDRRLTPVRSVGDFHVLELFHGPTSAFKDLGLQLLPQL
MRLALDPEDRIMILAATSGDTGTAALQGFKNVAQTGITVFYPDHGVSPIQERQMLTTTGN
NTRVFPIGGNFDQAQSAVKDLFTDTGFAARLQAEQVTLSAANSINIGRLIPQVVYYFSAY
LQLVESGAIELGQKVNFTVPTGNFGDVLAGFYAKLMGLPIHQLIAAANANHELADFLETG
IYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSSYVAKLMEELATTGRYQVRPDVLA
AIQADFAGGFAADAQIAASIAAVWKQNDYLLDPHTAVGYHVMQQYRETTGDSTPNVLLAT
ASPYKFPRAVAQALDLPVTGDDFAVMTQLHQMSGVPIPANLARLATLTAQPKHVVAPEEM
GQAIIAAAKEVFNNDQRVRSGNKR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacacaagtacacgggatcagcgcgttagcaagactggacaacaagcgatcaag
caaggcatctccgaagaaggcgggttatttgttttaccgcatctaacggattaccgcttg
aatcttcaaaatttattaggtaaagattatgaaacgattgctcagaatgttctcacgacc
ctgttgcctgattttaacactgctgcgttgaaaaaggcgatccaatttgcctatcataaa
aatttttctgatcgccggctgacgcctgttcggtctgtgggtgattttcatgttttagag
ctgtttcatggcccaaccagcgcctttaaagacttggggttgcaactactaccgcaactg
atgcgcctggcactggatccggaagatcgcatcatgatcttagccgcaaccagtggcgat
accgggactgcggcgttgcaagggttcaaaaatgtcgcccaaaccgggattaccgtcttt
tatcctgatcatggggttagtccgattcaggagcggcaaatgttaacgacaaccggcaat
aacacacgggttttcccaattggcggtaactttgatcaagcgcagagtgccgttaaagat
ctctttaccgacaccggttttgcggcgcgtttgcaggcggaacaagtaacgctttcggcc
gccaattcgattaatatcgggcgtttgattcctcaggtggtttattatttttccgcctac
ttgcaactggttgaatcaggtgccattgagcttggtcaaaaggttaatttcactgttcca
actggcaactttggggatgtcctagctggtttctatgcgaagttaatggggttgccgatt
catcaactaattgccgcggccaacgccaaccatgaactggcggactttcttgaaaccggt
atttatgatcgcaatcgtccgttcctaaagacggtggcgccaagtatggatattcagatt
tccagtaacttggaacggctactctactataagagtggtgaagatagcagttatgtggct
aaattaatggaagaattggccacaaccggccgctatcaggtacggcccgatgttttggca
gcgattcaggctgattttgctggcggttttgccgcagatgcacagattgcagcttcaatt
gctgcggtttggaagcaaaacgactatttgttggatcctcacacggctgtcggctaccat
gtgatgcagcaatatcgggagacaaccggtgattcgacccctaatgtgctactcgcaacg
gctagtccatacaaatttccacgcgcggttgctcaagcccttgacttgccggtgacaggt
gacgactttgctgtgatgacccagttgcatcaaatgagtggtgttccgattcctgctaat
ctagcgcgcttggcaactttgactgcccaacctaaacacgtggtggcgccggaagaaatg
ggccaggcgatcattgcagccgcaaaggaggtttttaacaatgatcagcgtgtccgttcc
ggcaacaagcgctaa

DBGET integrated database retrieval system