KEGG   Lactobacillus rhamnosus GG: LRHM_2263Help
Entry
LRHM_2263         CDS       T02100                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00010  Glycolysis / Gluconeogenesis
lrg00260  Glycine, serine and threonine metabolism
lrg00680  Methane metabolism
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01130  Biosynthesis of antibiotics
lrg01200  Carbon metabolism
lrg01230  Biosynthesis of amino acids
Module
lrg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrg_M00002  Glycolysis, core module involving three-carbon compounds
lrg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHM_2263
  Energy metabolism
   00680 Methane metabolism
    LRHM_2263
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHM_2263
Enzymes [BR:lrg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LRHM_2263
Membrane trafficking [BR:lrg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LRHM_2263
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LRHM_2263
  Exosomal proteins of melanoma cells
   LRHM_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAI42790
Position
complement(2425304..2425975)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQQNTYTGWSDVGLTAQGKAQAAAAGKKIAATGILFEHVHTSVLSR
AIMTAYIVQDAIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFYAH
PPLLAHPSRSRRYHAYPATIIPRGESLADASERLLPYWSAELAPRLMAGKNQLIVAHGST
LRALVKYMEAISDAGINKVEIGNAQPIVYTLDQHLTILNKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaattagtccttttaaggcatggcgaaagcattgctaatcaacaaaatacttat
actggctggtccgatgtcggattaacggcgcaagggaaagctcaagcagcagctgccggc
aaaaagattgcggcgaccgggatcttatttgagcatgtgcataccagcgtgttatcgcgg
gccattatgactgcctacatcgttcaggacgcaatcggccagaattacctgccgatcact
aaaagttggcgtctgaacgaacggcattatggcgccttacgcggaattaacaaagatctg
acccggaaactttttggcccggatcaagttgccagctggcggcgaagcttttatgcgcat
ccgccgttgttggcccatcccagtcgttcacggcgctatcacgcgtacccggcgacgatt
attccgcgcggtgaaagtcttgccgatgcgagtgagcgcctgttgccgtattggagcgct
gaattggcgccgcggttgatggccggcaagaatcagcttatcgtggcgcatggctcaaca
ttacgggcgttagtcaagtacatggaagctattagcgatgctggtattaacaaagttgaa
attggcaatgcccaaccaatcgtctacacgcttgatcagcatttaaccattctcaataaa
caaacactgtga

DBGET integrated database retrieval system