KEGG   Lactobacillus rhamnosus GG: LRHM_2428Help
Entry
LRHM_2428         CDS       T02100                                 

Definition
glutamate synthase small subunit
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRHM_2428
  Energy metabolism
   00910 Nitrogen metabolism
    LRHM_2428
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LRHM_2428
Enzymes [BR:lrg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     LRHM_2428
    1.4.1.14  glutamate synthase (NADH)
     LRHM_2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2589336..2590772)
Genome map
AA seq 478 aa AA seqDB search
MADPKGFLKYQRKDNPMRPIMQRVKDFDALELDVSMEERRKQAARCMNCGIPFCHHGVFY
GGGRAVSGCPNDNLIPEWNDLVYRAEDKRAFERLSRSNMLPDMTGRVCPAPCEVSCVQAL
NGPGVTIRNNEKYIIEQAFKNGWVIASGKPLQRTGKKVAVIGSGPAGISAAWRLNQLGHS
VTIFERDDRFGGFLMYGIPNMKLPKTVVQRRIETLKQVGIELVANTEVGKDISADELKRQ
FDRVIVCTGARQARELQVPGRELGGIVQAVDFLKTATQTVLKDGTQANTQLKGKRVLVLG
GGDTGNDCIATAIRQGCAGVTQLEITPALPPKRPAGNQWPEWPMTLKTGYGQKEAKALFG
GDVTTYAATVTAFFGEHGQVSEAEISQVDHFKPIAGTEKKVKVDLVVLAMGFTGPEADVF
DAFGITAKNANFTTNDTQIYVAGDCRRGPSLVIWGIHEGRMCAEKVDASLQTLASEAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcccaaaggctttttgaagtatcagcgcaaagataatcccatgcgtccaatt
atgcagcgggtcaaggattttgatgcgttggaactggacgtcagcatggaggaacgacgt
aaacaggcagcgcggtgtatgaattgtggcattccattttgtcatcatggtgtcttttat
ggtggcggtcgcgcggtcagcgggtgtcccaatgacaatctgattcccgaatggaacgat
ctggtttaccgtgcggaagacaagcgggcgtttgaacggttgagtcgctccaacatgtta
ccggatatgacaggacgcgtttgtccggcaccctgtgaagtttcctgcgttcaagcactt
aacggtcccggcgttaccattcgtaacaatgaaaagtacatcatcgagcaggcgttcaaa
aatggctgggttattgcatccggaaagccgctgcaacgtaccgggaaaaaagtggcggtc
atcggtagtgggccggctggcatttccgcagcatggcggcttaatcagttaggccattcc
gtgacaatatttgagcgggatgatcgcttcggtggctttttgatgtacggcattcccaac
atgaagctgccaaagactgttgtacagcggcgtatcgaaacgctgaagcaagtcgggatt
gaattagttgccaatacggaagtcggtaaagatatttccgcggatgaactcaagcggcaa
ttcgaccgggttattgtttgcacaggtgctcgccaggctcgtgagttacaagttccgggg
cgcgagttaggcggtattgttcaggcagttgattttctcaagacagcaactcagacggtc
ctcaaagatggcacccaagcgaatacccaattgaaaggtaaacgcgtcttggttctcggt
ggcggggacacgggcaatgattgtattgcaaccgcgattcgccaaggttgtgccggcgtg
acgcaacttgaaatcaccccagcgttaccacccaagcgtcctgctggcaatcagtggcca
gagtggcccatgacgttaaaaaccggttatggccagaaggaggcaaaagcgctttttggc
ggtgatgtgaccacctatgccgctacggtgactgctttctttggcgagcatggtcaagtg
agtgaagccgagattagccaagtcgatcattttaaaccgattgcgggaacggagaagaaa
gtcaaagttgatctggtggtgctggccatgggctttaccggtccggaagctgatgttttt
gatgcatttgggatcactgccaagaatgctaacttcacaaccaatgatacccagatctat
gttgctggcgattgtcgccgcggccccagcttggttatttgggggattcacgaaggccgc
atgtgtgcggaaaaagtcgatgcgtccttgcaaacattggcaagtgaagcgttatag

DBGET integrated database retrieval system