KEGG   Lactobacillus rhamnosus GG: LRHM_2428Help
Entry
LRHM_2428         CDS       T02100                                 

Definition
(GenBank) glutamate synthase small subunit
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00250  Alanine, aspartate and glutamate metabolism
lrg00910  Nitrogen metabolism
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01130  Biosynthesis of antibiotics
lrg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LRHM_2428
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LRHM_2428
Enzymes [BR:lrg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     LRHM_2428
    1.4.1.14  glutamate synthase (NADH)
     LRHM_2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 NAD_binding_8 Pyr_redox DAO AlaDh_PNT_C Pyr_redox_3 Amino_oxidase HI0933_like FAD_binding_2 FAD_oxidored NAD_binding_7 FAD_binding_3 GIDA FMO-like Thi4 AdoHcyase_NAD NAD_binding_9 2-Hacid_dh_C ApbA PALP NAD_Gly3P_dh_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAI42955
Position
complement(2589336..2590772)
Genome map
AA seq 478 aa AA seqDB search
MADPKGFLKYQRKDNPMRPIMQRVKDFDALELDVSMEERRKQAARCMNCGIPFCHHGVFY
GGGRAVSGCPNDNLIPEWNDLVYRAEDKRAFERLSRSNMLPDMTGRVCPAPCEVSCVQAL
NGPGVTIRNNEKYIIEQAFKNGWVIASGKPLQRTGKKVAVIGSGPAGISAAWRLNQLGHS
VTIFERDDRFGGFLMYGIPNMKLPKTVVQRRIETLKQVGIELVANTEVGKDISADELKRQ
FDRVIVCTGARQARELQVPGRELGGIVQAVDFLKTATQTVLKDGTQANTQLKGKRVLVLG
GGDTGNDCIATAIRQGCAGVTQLEITPALPPKRPAGNQWPEWPMTLKTGYGQKEAKALFG
GDVTTYAATVTAFFGEHGQVSEAEISQVDHFKPIAGTEKKVKVDLVVLAMGFTGPEADVF
DAFGITAKNANFTTNDTQIYVAGDCRRGPSLVIWGIHEGRMCAEKVDASLQTLASEAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcccaaaggctttttgaagtatcagcgcaaagataatcccatgcgtccaatt
atgcagcgggtcaaggattttgatgcgttggaactggacgtcagcatggaggaacgacgt
aaacaggcagcgcggtgtatgaattgtggcattccattttgtcatcatggtgtcttttat
ggtggcggtcgcgcggtcagcgggtgtcccaatgacaatctgattcccgaatggaacgat
ctggtttaccgtgcggaagacaagcgggcgtttgaacggttgagtcgctccaacatgtta
ccggatatgacaggacgcgtttgtccggcaccctgtgaagtttcctgcgttcaagcactt
aacggtcccggcgttaccattcgtaacaatgaaaagtacatcatcgagcaggcgttcaaa
aatggctgggttattgcatccggaaagccgctgcaacgtaccgggaaaaaagtggcggtc
atcggtagtgggccggctggcatttccgcagcatggcggcttaatcagttaggccattcc
gtgacaatatttgagcgggatgatcgcttcggtggctttttgatgtacggcattcccaac
atgaagctgccaaagactgttgtacagcggcgtatcgaaacgctgaagcaagtcgggatt
gaattagttgccaatacggaagtcggtaaagatatttccgcggatgaactcaagcggcaa
ttcgaccgggttattgtttgcacaggtgctcgccaggctcgtgagttacaagttccgggg
cgcgagttaggcggtattgttcaggcagttgattttctcaagacagcaactcagacggtc
ctcaaagatggcacccaagcgaatacccaattgaaaggtaaacgcgtcttggttctcggt
ggcggggacacgggcaatgattgtattgcaaccgcgattcgccaaggttgtgccggcgtg
acgcaacttgaaatcaccccagcgttaccacccaagcgtcctgctggcaatcagtggcca
gagtggcccatgacgttaaaaaccggttatggccagaaggaggcaaaagcgctttttggc
ggtgatgtgaccacctatgccgctacggtgactgctttctttggcgagcatggtcaagtg
agtgaagccgagattagccaagtcgatcattttaaaccgattgcgggaacggagaagaaa
gtcaaagttgatctggtggtgctggccatgggctttaccggtccggaagctgatgttttt
gatgcatttgggatcactgccaagaatgctaacttcacaaccaatgatacccagatctat
gttgctggcgattgtcgccgcggccccagcttggttatttgggggattcacgaaggccgc
atgtgtgcggaaaaagtcgatgcgtccttgcaaacattggcaagtgaagcgttatag

DBGET integrated database retrieval system