KEGG   Lactobacillus rhamnosus GG: LRHM_2544Help
Entry
LRHM_2544         CDS       T02100                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LRHM_2544
Enzymes [BR:lrg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LRHM_2544
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRHM_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704158..2705690)
Genome map
AA seq 510 aa AA seqDB search
MADSYIMAIDEGTTSTRAVILDHAGKMVGEAQKEFTQYFPKPGWVEHDANEIWEAVLSTI
ADTFISSGVQPRQIAGLGITNQRETTVIWDKTTGLPIYHAIVWQSRQTNALAEALRQAGH
GKMIHEKTGLLIDAYFSATKIRWILDHVPGAQERAENGELLFGTIDTWLSWKLSGGAIHV
TDYTNASRTMLFNIHTLDWDDEILQLLHIPRAMLPEVRSNSEIYGTGAAYHFFGSTVPIA
GMAGDQQSALFGQLALAPGMVKNTYGTGSFIVMNTGDKPKMSANNLLTTIAYGVNGQINY
ALEGSVFVAGSAIQWLRDQMGLVAQSPDTQQAAEAATSDDEVYVVPAFTGLGAPYWDAEA
RGAVFGLTRGTTKDDFIKATLQALAYQTRDVVDTMYKDTQIAVPALRVDGGAARNDYLMQ
FQADILNKPLERAANLETTAMGAAFLAGLAVGFWQDTDELKQIFQIGKRFEPRMTPARRE
NLYAGWQQAVAATQMFKHRPLPRTSTANNE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcagatagttacatcatggccattgatgaaggcacgaccagtacgcgcgcggttatt
ttggatcatgctggcaagatggtgggcgaggcgcaaaaggagtttacccagtattttcct
aaaccaggctgggtggagcacgacgcgaatgagatttgggaagcggtgttgtcgacgatt
gcggacacctttatttcgtctggggtgcagccgcggcaaattgcaggacttgggattacg
aatcagcgtgaaacgaccgtgatttgggataagacgacggggctgccgatttatcatgcg
attgtgtggcagtcacggcagaccaatgcgttggcggaagcgttgcggcaggctggtcat
ggcaaaatgatccatgagaagaccggcttgctgattgacgcctatttttccgctacgaag
attcgctggattttggatcatgttccgggagcccaagagcgcgcggaaaatggtgagctg
ctgtttggtacgattgatacgtggctgagctggaagttatcaggcggcgcgattcatgtg
acggactacacgaatgccagtcgaacgatgttgttcaacattcatacgttggattgggat
gacgagattttgcagttgctgcatattccgcgggccatgttgcctgaggtgcgcagtaat
tcggaaatttacggtaccggcgcggcttatcatttcttcggcagcacggttccaattgca
gggatggccggtgaccagcaaagcgccttgtttggccagttagcgttggcgccggggatg
gtgaagaatacatatggtactggctcgtttattgtgatgaatacaggcgataagccgaaa
atgtctgctaataacttgttgacgacgattgcatatggcgtgaacgggcagattaattat
gctttggaaggctcagtgtttgtcgcaggttcggcgattcagtggctgcgcgatcaaatg
gggttggtggcgcaatcgcctgacacccagcaagcagccgaggcagccactagtgatgat
gaggtttatgtggtgcctgcgtttacaggcttaggggcaccgtattgggatgccgaagca
cgcggggcagtttttggcttgacccgcggaaccactaaagacgactttattaaagcgacg
ttgcaggctttggcttatcaaacgcgtgatgtggttgataccatgtacaaggacacacaa
attgctgttccagccttacgcgttgacggtggggcagcccgcaatgattacctgatgcag
tttcaggcggatatcctgaataagccgttggaacgagccgccaatttagagacgaccgct
atgggtgctgcctttttagcaggattggcagtcggcttttggcaggatacggatgaactt
aaacagattttccaaattggcaagcggtttgaacctcgtatgacaccggcgcggcgggag
aatttatacgccggttggcaacaggctgttgcggccacgcagatgttcaagcaccggccg
ttaccacgaacatccactgccaataacgaataa

DBGET integrated database retrieval system